Search Results - WLN Updates

Search of Tags for "virtual-reality"

Legends of Tarthirious: Book Five of Kylia's Story
Legends of Tarthirious: Book Three of Kylia's Story
Legends of The Great Savanna - Complete Book 1, Ongoing Book 2
Legends of the Six Realms
Legends of The Worlds Gate
Legends Of Valkyries:Endless war on Middle Earth
Legends of Zyantra: Immortals
Legends Online
Legends Reborn Online
Legends Within the Weft
Lemondream
Let Me Explore The Interstellar in Peace
Let's Play: Chronicles of Zurefgar
Leveled Plane
Leveling Up through Eating
Levia Codex
Ley World-The Game
Life in a Game
Life Mission
Life Reset
Life::Uploaded
LifeCraft
Lightning Watt
LimeLight: The Galaxy's Deadliest VR Gameshow
Limit Break
Limit Breaker
Limitless Lands
Lingering Elements
LITRPG (Book II) - Mecc 12 : Cannon Fodder (Unedited)
LITRPG - Planting a Seed (Unedited)
LitRPG: Grand Age - Lord Of Bloodlines
LITTLE GOBLIN: Master, Don't Come Here!
Living in His Dreams
Living in His Dreams (Ongoing)
LMF = Legendary Midnight Farmer
Log Horizon
LOGIK: Slow Healing Life Online
Loiterous
Long Island
Long War
Long War [Old]
Lorctbvrorpgiraadhesgiaclswintrashwmdlsamygiadwimtdkagmactbapdsbihtaoatln?!
Lord of Glory
Lord of the Seas
Lord Shadow
Lord's Domain
Loser of Tarinath
Lost Archive
Lost Boys
Lost Child