Group RoyalRoadL

Group Aliases

  • RoyalRoadL

Series

𝕽𝖊𝖇𝖊𝖑𝖑𝖎𝖔𝖓
🌿Vinal Fantasy: The Vinal Countdown. Vines Vines 🌱
"Because I am Tianzi Daiyu!"
"Conquerors Domain" By xipzo
"Fight!"
"God's" Door
"I Am The Hero"
"Idol" Is The Strongest Job In This World! – Reincarnated as an Idol!
"Not Decided"
"Not your typical Demon King"
"Reincarnated?" Only To...
"Talented"
"Untitled"
"What do you mean, 'You're an ex-familiar'?!"
"Why Does My Crush Have Tentacles!?"
"Without You". Reincarnated as a Troll Alternative. 2018' NaNoWriMo
# Gaea 1 - Blood of the Pure
# Gaea 1 - Blood of the Pure (COMPLETE)
# Gaea 2 - Light of the Shadow
# The Gemstone of Ominium 1 - Denial
#1 Shadow
#199
#Zero Wonderland (Code Zero Wonderland)
>Input Log Dates
<< Lucid Dream >>
'Daikon' Ball
'Pay to Win' Cannot Help-
'Project Desperia'
'S Demise
( REBOOTED ) Reincarnated Inside (RPG GAME) With Modification System
(Anti)Hero Chronicles
(BL) System, WTF!
(Cancelled) A Purgatory Beast's Summoning
(Cancelled) The Shadows Embrace Me
(Defunct)Spaceship Reincarnator
(DEMO) Colorless vol.1- Phantamoire Enigmata
(Discontinued)
(Discontinued) Aevitas - Not an NPC
(Do) Re:Mi
(Draft 1- Not Latest Release) Becoming the Protagonist of My Own Delusional World!
(Dropped) - Gachapon
(Dropped) Crown of the martyr and martyr of the Crown.
(DROPPED) The Snake of the Fan
(Dropped)The Ancient
(Dropped)The God Of Apocalypse
(First Draft Old Version) Ruins Of Isulia ~ Book 1 : Awakening of the Emarine
(Game + Divinity) - Heroics = Our Reality
(Hiatus) Dungeon Defender
(Hiatus) Restaurant of The Devourer
(Indefinitely paused) The Stone-hearted Enchanter
(Merged into Burra: Short Stories In the Shaper Universe) Enlarge
(Moved) RE: Divine Laws of Mind, Body, & Soul
(No Name Yet)
(NOW EDITED WITH NO WALLS OF TEXT!)Age of Teras: Monster Evolution
(OLD)Play On! My Lovely Goddess!
(ON HIATUS) Immortal Mage
(On Hold) Regarding my time being a God, it was fun
(Pokemon Data-Visored) The Adventure of Viole
(R)Evolution of zombie
(re) Kobolt on Yggmathall
(Re)Install
(Re-write) House Cazador: The Imperial Lion
(Reboot up)
(REWRITE) The Golden Watch Of Hypnosis
(Suspended) The Helix; The Arc,
(The Convertion)
(Un)Luckiest Person On Earth?
(un)Lucky
(Un)necessary Evil
(Un)Paralleled
(Un)Prophesied Heroes
(Updated) Ruins of Isulia ~ Book 1 : Awakening of the Emarine
(Web Novel) Betrayed in a Blessed World
(Work In Progress)
(Work In Progress) Werewolf Survival - A Dark Fantasy GameLit Interactive Adventure
***ABANDONED***It Was the Best of Slimes, It Was the Worst of Slimes
***DISAVOWED*** Not A Princess Story
*A Dwarf's Story*
*A Fool's Errand*
*DING* : A Dreamer's Game
*DISALLOWED* The Light and Ages Saga: Reference Books
*DISAVOWED* DemonAge
*DISAVOWED* Descendants: Tales of Half Gods
*DISAVOWED* Fireheart: Age of Shadows
*DISAVOWED* Gemini
*DISAVOWED* Masters of The Elements
*DISAVOWED* The Machine Saga Vol. 1 Ral'mus
*DISAVOWED* Twilight of the Gods
*Discontinued*
*Generation One* *The Golden Sapphire Saga* *Saga 3*
*Generation One**The Anti Magic Ritual**Arc 6*
*Insert Title That'Ll Hook You In Cause I Don'T Know What Title To Think Of*
*The Nephilim Chimeras**Generation One**Saga 4*
+1
- Hp
---
--Aegis--
--Blacksmith's Ire, Book 1 of the Vengeance of the Wind Trilogy--
-An Unusual VRMMO Experience-
-Lost-
-Scarlet Surge-
-The World Saga-
-World of Infinite Possibility-
... And My Skillet
...Excuse me, but how do you expect me to defeat the Demon Lord when I only know how to heal..?
.The Dark Stranger.
.Wip.
0 Damage Assassin
0.1.0
1 Vs Tthe World
1) DECK: Annoying Dreams
100 Days
100 Luck and the Dragon Tamer Skill!
100 Ways to Make Money in a Fantasy World
100 Words
1000 Cranes For Love
1000 Lives Relived
1000-Hit KO
10k Years Silent Cultivation
110 Fanfiction
12 Hand Asura
12 Miles Below
12 Zodiac!!
13 Clans of Gods: Book One [The God of Void]
13 Dimensions
13 Seconds
13.Ai
139 Years to the End of the World
13th Soul- Book 1 The God Slayer
18 Purifying Magics
2 AM in Woodstock, New Hampshire
2 Worlds
2'n Aloysius
2.5 D adventure
200X300
2025
2025// The Sect Of Symmetry
2040: Queen of Nowhere
2040: Reconnection
2100
2278
23 Doors
23 Pangbourne Place
2332: Fleeing the Arrakis
24
24 The Conspiracy
243 Wanderers
2450 - Age of Corporations
299 441 Yen
2nd Chance
2Nd Chance: The Beginning
3 Bastards and a Red Slipper Demon Queen
3 Hearts
3 Kingdoms
3 Squirrels and an Alpaca
3.0.1
365 Days in Another World
3D/2D: I Got Sent to a Fantasy World and Turned into an Anime Character?!
40 Thousand Reasons
46 Year Old Syndrome
48 Hours
49 And One Hero.
5 Dragon Emperor
50 And Above
52 Stories
7 Desire 7 Death , a way you chose me
7 Dragons and Princess
7 Envoys of the ends
72 Hours
777
7th Chronicle: Utopian Road
8.29Mm
8th Deadly Sin
8th Sense
9 Circles of Hell
9 Dragon War God
9 Levels of Hell - GameLit
9 Lives
90%
9001: A Dungeon Ship Odyssey
9001: The resurrection of the Dominion
99 Dungeons: The Beast Lord
999 Ways To Die In A Ruined World
:Re.re.Re: (Completed)
=
[ Entity ] : Reincarnated soul
[ Entity ] : tale of those kings
[ Magical Amputee]
[ The Administrator ]
[18+] A Little Sister'S All I Need | 我只需要我的妹妹
[Abandoned]
[Alternative Recode]
[ARC.] Survival Online
[Archive] Legend of the Nameless Hero
[Avalon]
[Backup Online]
[Book 1.0] -- Perth'S Accidental Superheroes
[CANCLED] Erwin Siegmar [First Draft?]
[CANCLED] Flesh and Iron [First Draft?]
[Censored]
[Chronicles of Sevestia] Book 1: Rebellion
[Conquerors Of The Delve] [Abandoned]
[Cyborg] - In A World Of Magic
[CYOA] Mastrya
[Deprecated Story No Longer Being Worked On]
[Discontinued] After the Fall
[Discontinued] Armus : First Draft
[Discontinued]「Atelier;Magus」
[Don't Die!]
[Dragon child]
[DROPPED] A King From Another World
[DROPPED] An Empty Throne
[DROPPED] City Dungeon Abyss
[DROPPED] Heroes and Villains
[DROPPED] I threw away the legendary cat ears
[DROPPED] I Want To Live and Enjoy Life!
[Dropped] The Eighth Child
[Dropped] The Former Cultivator Who Now Plays VRMMORPG's
[Dropped] The Teacher and Disciple
[Dropped] Truck Driver Reincarnation
[Earth Reborn]
[Email Protected]
[English] Tanaka no sujiganeiri no monogatari (Hardcore Tale of Tanaka)
[FIRST DRAFT - needs major editing] Licentia - Child of the Abyss
[First Draft, Moved] Of Astral and Umbral
[French] Les Pions de l'Equilibres
[Frontier Online]
[German] Mand'alor The Undying
[German] Path of Evolution Johannes: The Shackled // ...
[German] RE:HUNDERT -Leben in einer anderen Welt-
[Guardian]
[Hiatus] City Dungeon Abyss
[HIATUS] Dragon Scythe Online
[hiatus] Dungeon Run
[Hiatus] God of Plants
[Hiatus] In my second life, I will continue being a virgin.
[Hiatus] My fiance is an alien
[Hiatus] Player: Level 0
[HIATUS] Re:Turn, The Legend of the 4 Swords
[HIATUS]A Beautiful Twilight
[Indonesian] Great world traveler
[Kancolle] Diary of an Admiral
[LitRPG] Kernstalion
[LitRPG] The Bayani - Isaiah
[NaNoWriMo] A Simple Life of A Farmer: Farming 101
[NaNoWriMo] A Tower of Hats
[NaNoWriMo] Apocalypse Master
[NaNoWriMo] Don't label me!
[NaNoWriMo] I died and was resurrected... on Earth?!?!?!!
[NaNoWriMo] Masqueraider of Dofus: Incarnam
[NaNoWriMo] The Mortal God's Melancholy
[NaNoWriMo]Author's Note
[Nexus] - Chaos Deficiency
[On Break Need Some Fixing] Rebirth of Versatile Mage
[OUTDATED] Paths of the Chosen
[Placeholder] Arachne in a different world
[PORTUGUESE] Saint Seiya: Kagutsuchi, o cavaleiro de Fornalha.
[PORTUGUESE] The Rise of a New King of The World ?
[PUBLISHED] Substation Seven: Condemnation
[Re] Cultivating the Universe
[RE] System
[Reboot]The Strongest Skill: Getting Rich while Becoming Stronger
[RETIRED] Gamer's Guide to Waking up as a Dinosaur
[Runist]
[Second Saga]
[Semi-Webtoon] Moments In Time
[Semi-Webtoon] My Shifter Academia
[Semi-Webtoon] Shifters
[Semi-Webtoon] Shifters (OLD VERSION)
[Semi-Webtoon] Shifters [participant in the Royal Road Writathon challenge]
[Short] behind your smile | 你的笑容 (COMPLETED ✓)
[Spanish] Ciudad del Alquimista
[Spanish] Hibrido en un mundo magico
[Spanish] Odisea [Furry/Yiff]
[THTG] The Hand That Guides
[Trance Revival]
[Untitled]
[Webtoon] Prophecy Online : Odyssey of Potato
[What If] : To Love Ru
[WIP] ORBs, a LitRPG
[XVA] Fallen Zeal
A "boring" Game.
A "Living" Weapon Named Death
A "Typical" Dungeon Capture
A 3% Chance for Glory
A Ai`S Adventure In A Different World In Space
A android,a ghost ,a immortal,a necromancer and a council in a bar
A bad deal.
A Bag Of Bones
A Bard's Song: Lore
A Bard's Tale
A Battle of Eyes Against the Gods
A Battle Torn Heart
A Battlefield of Swords and Flowers
A Beastmaster's Tale
A Beautiful Nightmare
A Beautiful Twilight
A Beautiful Woman of Science and Other Absurdities
A Beginner's Guide to Napping, Sunbathing, and Slaughtering Your Prey
A Beginner's Guide to Otherworld Cult Management
A beginning
A Beginning and its End
A Beholder's Path
A Billion Players
A Binding Soul
A Bit of Everything
A Black Man Reborn in Jiang Hu!
A Blacksmith's Tale. A LitRPG Story
A Blade's Shadow
A Blank Tale
A Blazing Journey: A New Beginning
A blend of everything
A Blighted World
A Blind Descent
A Blond Ray of Sunshine
A Bloody Game
A Bloody Mess: An abnormal story
A Boku No Hero fiction
A book fanatic's Journey through a Fantasy World
A Book to Remember
A bored boy looking for reason
A Bored Goblin's Journey to Pass Time
A Bored Immortal
A Bored Immortal's Adventure with Reincarnation
A Bored Passerby With Some Cheats
A bored story (Hiatus)
A Boy's Simple Ambition
A Boy's Wish
A Brand New Day
A brave new, Scary world
A Breath of Fresh Air
A Bride for Seven Brothers
A Bride For Seven Brothers (Sample)
A Bride in Diyu
A Broken Doll and her lost Soul
A Broken Kingdom
A Broken World
A Broken World [Dropped Pending Rewrite]
A Broken World [Rewrite]
A Budding Scientist in a Fantasy World
A Bunnerfly in the Desert - A Kammiverse Story
A Butler in a Noble House - a Fruitless Endeavor
A Bygone Era
A Canopy of Stars
A Caregiver's Last Lesson
A Castle and a Tomb
A Castle in a Teacup
A Cat Is Fine Too
A Celestial's Wrath
A Century Later
A chance
A Chance Again
A Chance To Become a Adonis
A Chance To Become An Adonis
A Change In The Same World
A Cheap, OP Brawler
A Cheap, OP Brawler (Currently on Hiatus)
A Cheat Cultivation Level
A cheat that allows me to build a city in another world ?!
A cheat that allows me to build a city in another world ?!(canceled due to time problems sorry)
A Child of Moon and Sun
A Chitinous Journey
A Chuunibyou's Life in Another World!
A City Stranded Cowboy's Robot Mercy Killing Business
A Civil Minotaur In An Uncivilized World
A Cliché Multiverse Story
A Cliché Reincarnation
A Clone of Arth
A Cockroach's guide to magic
A Coder's Guide To Magic
A Collection Of Ideas. True's Oneshots.
A Collection of Short Stories: Quiet Girl
A Collection of Tales
A Collection of the CRAZY STORYTELLER
A Collection of Thoughts
A Colonist's Woes - Warhammer Fantasy
A Compendium Of Realities
A Compendium of Useless Powers
A complicated man with a simple dream
A Comprehensive Guide for Alchemy
A Conflicted World Needs Our Help, So a Goddess Sent Us On Our Way
A Conqueror's Tale
A Conquest of the Stars: The Heart's Anguish
A Convenient Fiction
A Couple's Journey In Another World
A Crack In The System
A Cultivation Realm Dungeon
A Cultivation Story
A Cultivator in a Magic Filled World
A Cup of Moondust
A Curious Bird
A Curious Case of Mobs Extra
A curious cat's life in a new world
A Curious World
A Curse in the North
A Cursed Life.
A cute duckling in an ugly world
A Cute Woman and Her Clingy Husband
A D&D Gamer in Garweeze Wurld
A D-rank Adventurer's Bizarre Reincarnation
A D-rank Adventurer's Bizzare Reincarnation
A Daemon's Gamble
A Dance between Mortals and Immortals.
A Dance of Light and Shadow
A Dance Of Poison And Curses
A Dance of Wyverns
A daring synthesis
A Dark and Dangerous Place
A Dark Connection
A Dark God In A Darker Multiverse
A Dark God In An Otherwise Godless Multiverse
A Dark Prophecy of the Last Age: From One War Torn World to Another
A Dark Road
A Darkened Realm
A Dash'in Legacy
A Day With The Cross Dimensional Traveling Truck Driver
A Dead God's Wish
A Dead Man's Tales
A Deathly Contract
A Degenerate's Tale
A Degenerates Book for Survival
A Demon Between Worlds
A Demon Lord NEED HELP!
A Demon lord's dilemma
A Demon lord's dilemma(dead)
A Demon Lord's Reincarnation
A Demon Lord's Virtual [Magic Life]
A Demon Resides in My Phone
A Demon Within
A Demon's Gift
A Demon's Journey
A Demon's Ordinary Survival Story
A Demon's Tail
A Demon, Probably
A Demonic Conquest
A Demons Evolution
A Demons Evolution (Hiatus)
A demons Promise
A Deranged World
A Descendant To God
A Descent Into Madness
A Dessert of Dreams
A Destructive Incarnation
A Devil's Child
A Diary of Fantasy and Dreams
A Diary of Tressure
A Different Destination
A Different Kind of God
A Different Kind Of Hero
A Different kind of Hero (Marvel)
A Different Kind of Hero (Will Be Revised)
A Different Kind Of Journey
A Different Path To Follow
A different point of view
A Different World Where The Demons Are Good
A Disciple from Beginning, A Master to End
A Dissonance in Harmony
A Ditto's Tale
A Diver's Tale
A Divine Demonic Dragon
A Dog with a Chair
A Dog's Loyalty
A Dose of Nonsense
A Draconic Insurgency
A Draconic Odyssey
A Dragon Among The Stars
A dragon familar
A Dragon Gnawing Its Tail
A Dragon Idol's Reincarnation Tale
A Dragon In human Skin
A Dragon in the System
A Dragon With Fur
A Dragon's Curiosity
A Dragon's Dungeon
A Dragon's Grimm Cultivation
A Dragon's Treasure: A Reincarnation Story
A Dragonoid's Tale
A Drastic Step
A Dream
A Dream Eternal
A Dream of Crows
A Dream of Wings and Flame
A Dream to the Summit
A Drop of Water & Blood
A Dryad isn't just firewood
A Dryflame Child's Life (Rewriting)
A Dulled Blade
A Dumb Girl in a Cultivation World
A Dungeon Core
A dungeon core story: Magic with a hint of Science
A Dungeon Game
A Dungeon in Space
A Dungeon of Fate and Fae
A Dungeon Of Fire And Death ( english ) Eine MI des Feuers und Todes ( german )
A Dungeon Tested
A Dungeon's Journey
A Dungeon's life
A Dungeon's Republic
A Dungeons Quest
A Dying World [DROPPED]
A failure's hopeful journey.
A fairy tale for the nephilim
A Familiar World
A Fantasy in Time
A Fantasy of Everglow
A far universe story
A Farmer's Strength
A Farmers Life For Me
A Fate Set in Stone (On Hold)
A Female Rogue's Adventure Through Two Worlds
A Female's Take on The World of Cultivation
A festering world
A Festival of Fools
A Fiery VRMMORPG adventure
A fine octet of legs
A Fire
A Fire Magician.
A Fish's Tale
A Flower in Death's Embrace
A Flower underneath a Willow
A Fly in Cultivation Universe
A Fool fooling around in another world
A Fool's Vagrancies
A Forbidden Contract
A Forced Hero
A Forest Dungeon
A Forgemaster Of Wayland
A Forgotten Hero
A forgotten ruler
A Forgotten Soul
A Forgotten Specter
A Forgotten Vampire
A Former Hero's Journey: I just want to live peacefully!
A Fourth Dimention Reality
A Fox Amongst Wolves
A Fox at Heart
A Fox in the Woods
A Fox's System
A Fractal Divide
A Fractured Song
A Fractured Soul
A Fragmented Mind
A Friendly Shadow
A Friendly Voidling
A Frozen Conquest!
A Fungal Dream
A Future Destroyed - A Post-Modern Fantasy LitRPG
A Galactic Dictator's Adventures into a Magical World!
A Galaxy, Alive
A Game For Monsters
A Game Of Chess
A Game of Dancing Pieces
A Game of Hedrons
A Game of Life
A Game of Unknown Origins
A Game of Villains
A Gamer But I Also A Realist That Do Not Believe Anything That Not Disprove
A Gatored Community
A Gem To Be Remembered [bl]
A Generic Dungeon Core Story
A generic love story
A generic love story: disturbance
A generic love story: Transcendence
A genius of none
A Gentleman's Curse
A Gentleman's Curse: Arc 2
A Ghost in the House of Iron
A Ghost Life
A ghost's tale
A Ghoul's Legend
A Giant Among Dragons
A Girl and Her Fate
A Girl and her Goat
A Girl's, Unusual Existence
A Gladiator's New World [HIATUS]
A Glass Window
A Glimmer in the Dark
A Goblin's Blade (dropped)
A Goblin's Evolution
A Goblin's Tale
A God in a Xianxia world
A God In The Bay (Worm/Massive Crossover) (Worm Quest)
A God's Chosen
A god's crime against humanity
A God's Freedom
A God's Fun Time
A God's Game
A god's Perspective
A God's Pub
A God's Purpose
A Golem And Puppets Adventure
A Golem in a Cultivation World.
A Good Bargain [HIATUS]
A Good Man
A Good Night's Rest
A Grand Journey
A Gray and Grey world
A Guard's Dream
A guide to hero killing
A Guide To Immortality (discontinued)
A Gun in a Dungeon
A Gun is the Strongest Weapon in a Fantasy World!
A guy reincarnated as a sloth and is too lazy to be a protagonist
A guy reincarneted as a sloth and is too lazy to be a protagonist
A Guy, A Latte and Status Screen.
A Half Hour to Kill
A Hand In Darkness
A Hand-Woven Universe
A Hard Game (Dropped)
A Healer's Gift, An Adventurer's Heart
A healthy mind in a healthy body
A Heart of Ice (hiatus)
A Herald for Spirits
A Hermit's Life for Me
A Hero Past the 25th
A Hero Past the 25th: Old Empire
A Hero Past the 25th: Paradise Lost
A Hero Returns
A Hero Returns (On Hiatus)
A Hero to Only One. (Completed)
A Hero turned Succubus's Tale
A Hero's Brother
A Hero's Common Sense
A Hero's Legacy
A Hero's New Beginning, Again...
A Hero's War
A Hidden Secret
A Hidden Vampire Class????
A Hidden World
A High God's Reincarnation
A Highest Rank in Another World!
A History Buff Brought to Another World
A Horcrux's Fate
A Hunt For Crows
A Hunt Upon Wings of Shadows
A Hunter's New Home
A Hunter's Wings [Rewrite]
A Hymn of Blood and Curses
A Jaded Life
A Jedi was on the Planet Alderaan.
A Jewel's Worth
A Job for a Wendigo
A Journey Away - Book One of The Eternal Flame
A Journey in Darkness
A Journey Into Mario World
A Journey of an ordinary girl in a fantasy world
A Journey of Black and Red
A Journey of Chaos and Glory
A Journey Of The Fated Conqueror Part 1: Mortal Realm
A Journey Through Frost and Snow
A Journey Through the Worlds.
A Journey To Remember
A journey to the beginning
A Journey With Gods and Monsters
A Jump Into Fantasy
A Just God's Angels
A Kid and His Slime
A Killer Reborn
A King From Another World
A King of His Own
A King of Old
A King's Bargain (Legend of Tal #1)
A King's Regret - Ravenchild
A Kingdom of Power, of Courage, and of Wisdom
A Knight Of Humanity
A Knight's Promise
A Knight's Redo (Completed)
A Knight's Will
A Land Without Kings
A Lasting Fury By Replica1
A lazy king
A Lazy Programmer
A League Apart - Journeys to the Beacons
A Legend Reborn
A Legendary Tale: From rags to divinity!!!
A librarian
A life of excitement
A Life of Terror.
A Life Rewritten
A Life's Journey
A Life's Lie
A Lifetime Promise
A Liliful World
A Little Bit OF A Silverlining HIATUS
A Little Bit Of Motivation
A little bit of Villainy
A little case of a supernatural affair
A little Kitty's journey though a random world
A Little Sister'S All I Need | 我只需要一個小妹妹
A Lone Automaton's Journey To Find Its Operator
A Lonely Dungeon
A Lonely Girl's Journey to Immortality
A Lonely Tree
A Loner's Calling
A Long Fall From Grace
A long slumber.
A loose Page
A Lord of Death
A Lost Man
A Lost Necromancer's Saga
A Lotus Of Death
A Love at Stake
A love so divine!
A love to kill!
A Lover Siblings in Royal Road!
A Madlad in a Magical Apocalypse
A Magic Sniper in Another World [Hiatus]
A magical fox Stole my body and gave me its
A Magical Journey
A Magical Life: Ink Swan
A Magus Among Cultivators
A Maiden's Frozen Heart
A Maiden's Strange Voyage
A Mailman as a Superhero
A Major in Necromancy
A Man and His Greatsword
A Man and His Gun
A Man and the Sea
A Man At Arms
A Man in the Gods' World
A Man Led by the Heart of Another World
A Mao's Tale
A march of fire
A Martial Odyssey
A marvel rise
A Master, 5 Students, and Revenge [AM5SR]
A Master, 5 Students, and Revenge [AM5SR}
A Maze of Glass
A mean Demon Queen Kidnapped me!
A Meaningless Hero
A Mediocre Supreme Cultivator
A Melody of Fire and Lightning
A Merchants Tale
A Mere Fate of Mine
A Mermaid's Responsibility
A Meta-Human In Another World
A Metaverse Dungeon - Foodie's Enigma
A Mildly Odd Reality Breaker
A Mob Boss's First Love (Book 1 of the New York Mafia Series)
A Modern Cultivator's Dilemma
A Modern Day Demon King
A Modern Man in a Cultivating World
A Modern Roman Empire
A Moment in Time - Eternal Best Plans Desire Bat - Descending in Darkness
A Monarch of Fate
A Monarch's Quest
A Monster's Jaunt
A Most Unfortunate Summoning
A moth of winter - A Kammi Kettu fan story
A Mother's Bond Taken After Death
A Mouse in the Circuitry - A Kammi Kettu Story
A Music Prodigy
A Mutant Magus's Journal
A Nanomachine Magical World (A LitRPG Adventure)
A Nation of Riflemen
A Naturalists Dungeon
A Necromancer's Village
A Needed New Start
A nerd in another world
A Nerd's Wet Dream Come True (Tossing an OC into DC Comics)
A Nerd's Wet Dream Come True (Tossing an OC into Dc Comics) V.2
A Nerd's Wet Dream Come True (Tossing an OC into Marvel)
A Nerd's Wet Dream Come True (Tossing an OC into Marvel) V2.
A Nerd's Wuxia Tales
A NERF Playboy vs The World
A New Adventure
A New Beginning By Aerebes
A new Breath Online
A New Breed of Pirate
A New Breed of Pirate: A VRMMO Tale
A New Continent
A New Dawn
A New Dawn (Old Version)
A New Goddess
A New Human
A New King
A new leaf (Old version)
A new life
A New Life (zod119)
A new life in a new world.
A new life of a boy (working title)
A New Life Through The Eyes Of Kanto: An Autobiography
A New life with the choice of destruction or creation in a new world(hiatus)
A New Line Through The Lives Of Kanto
A New Loli Life On A Fantasy World!
A New Path
A New Path, Chosen freely
A new quest!
A New Shroom Life
A New Story
A new world
A new world a new Chance(DROPPED)
A New World To Call Home, As Sloths Representative
A New World: Eve
A New World? I'll Do What I Want!
A new zombie apocalypse
A Night in Emerald Forest
A ninja transported to another world
A Noble Isekai
A Nobody Special
A normal man's journey
A Not Quite Parallel World Story
A Not So Dark Soveriegn's Rise
A Novel World
A Numbers Game
A Parallel Dream
A Path of Business: My Loyal and Lovely Husband
A Path Of Rage
A Path to Crown
A Path to Magic
A Pawn of Chaos in the Game of Fate
A Pawn of Chaos in the Game of Fate - Revision
A Pawn of Chaos in the Game of Fate - Rubble Rats
A Pawn of Chaos in the Game of Fate [Pre-edit]
A Petal Torn of Shapeless Thoughts
A Phoenix's life
A picture is worth a Chapter
A Pipe Dream
A Pirates life isn't always gold
A Place to Belong - A LitRPG Adventure
A Place To Send Chapters
A Place Under the Ocean
A Place Without Wind
A Play ground for an Undead Lord
A Player in the Greenwood
A Playground For The Powerful
A Polite Society
A Portrait Of A Witch
A Power Manipulator's Multiversal Adventures
A Powerful Duke In Another world
A Practical Guardian
A Practical Guide to Sorcery
A Pre-Apocalyptic Rebrith
A Price In Memory
A Price In Memory (Aspect of the Beast Rewrite)
A Princess Melody
A Princess of Alfheim
A Princess, a Dragon, a Rogue and One Other Guy
A Profane Weapon's Wonderland Fantasy
A Professional Reader's Guide to Amateur Writing
A Promise
A Promise Marked by Fire
A Prose of Years
A Protector's Circumstance
A Protracted Game [Web Serial]
A Psychic's Scarlet Dream
A Psycho in a Ruined World
A Psycho in the Ruined World
A Psycho's Diary
A Puppeteer's Journey
A Queen of Ruins
A Quest for a Cure
A Quest for Existence
A quest to reveal the truth of humanity
A Question of Character (shelved)
A Questionable Persons Questionable Look At Life
A ragbag of stories, don't expect them to end.
A Random story of an Adventurer
A Rather Unfortunate Gun-Wizard
A Rational Zombie (Complete)
A Rats Life
A Raymond's Raven - (The Exploration of Magic in World War 1)
A Real Life
A Reaper's Tale
A Rebellion of The True Heir
A Reincarnates Story
a Reincarnation full of choices
A Religious Witch?! How Incredbile!
A Restart on Life
A Retelling of Twilight Princess
A Retired Vets New Life: An Apocalyptic Novel
A Robbery Of Goats
A Robin and A Crow
A rogues life in another world
A Rogues Life in Another World (Draft 1)
A Romance of Villains
A Rotten Soul
A rotten soul (short hiatus)
A rouges life in another world
A Royal Warrior
A Safe Place
A saga of Alviona, a girl who would be known as Crimson Queen
A Sage's Different World Logs
A Satisfactory Isekai Situation
A Savage's Journey
A Savage's Journey (Previous Gambler's Den)
A Savage's Journey (Previously Gambler's Den)
A Saviour's Endeavour
A Scientist And His Hi-Tech Laboratory Suddenly Transported In Another World
A Scientist in a Fantasy World
A Second Chance
A Second Chance (Invasion Book #1): LitRPG Series
A second life
A Sehealian Chronicle
A Series of One Shots
A series of Short stories
A series of Transmigrated Misadventures.
A Serpentine Tale {Dropped}
A Servant of Justice
A Servant of The Empire
A Sh Ai El
A Shade Underneath the Heavens
A Shadow
A Shapeshifting ________!
A Shard falls from the Heavens
A Shattered World
A Shifter's Journey
A Shifters Journey
A Short Story Collection
A Sick Twist of Fate
A Silvertongue's Tale
A simple book
A Simpler Reality ( Revised )
A Single Thought
A Sinner's Chance
A Siren's Call
A Sister'S All You Need | 如果有妹妹就好了
A Sith's Journey
A Skazka
A Skill Whore's Journey
A Skin-Changer's Tale
A sky as blue as ours
A Sky of Star and Strength
A Slave's Voice (Revision Pending)
A Slayer's Diary
A Sleepless Apocalypse
A Slice Of Life Of Broken Man
A slimes time
A slip into fantasy
A Slip Of The Force
A Small Town Called Cadaver
A Smidge of Magic
A Smile To Remember...
A Snail's Wisdom
A Snake's Life
A Snake's Rise
A Soldier Tale
A Soldier's Dream - Elementum Adamantinus Purifico
A Soldier's Fragmented Memoire
A Soldier's Life
A Solitary God In A Dark Multiverse
A Song Calls Them Home
A Song for the New Age
A Song of Goblins and Skeletons
A Song of Ice and Fur
A Sorcerer's Footsteps
A Soul Bound Dragon
A Soul's Dream
A Soul's New Home
A Soul's Wish
A Space Odd-yssey?
A Splash of Death
A Standard Superhero World
A Star for Every Soul
A Star is Born
A Step Behind Death
A Step into Madness (Dropped)
A Step-by-Step Guide to Conquering a Fantasy World
A Storm in the Fall
A Story about a Magic Book
A Story About a Vampire
A Story From June
A Story in Black and White
A story in which numerous people die
A Story less Told (The legend of Adrian Michael Greggarious, book 1)
A Story Of Blue Boxes And Cats
A Story That You Wouldn't Want To Read +
A Story To Choice From (10 One Shots)
A story where every chapter is chapter one
A story where the main character is too Op!
A Strand of Divine Sense
A Strange Love
A Strange Soul
A Strange Soul Rewritten
A Stranger in Sorcererstown
A Stranger in Sorcererstown (The Stranger Trails Saga)
A Struggle Through the Deadly
A Student's Journey through Magic and Mayhem
A Student...Like You
A Students Gate to Hell
A Study in Rain
A Succubus System? But I'm a Virgin!
A Sudden Cute Baby: My Awesome President Dad
A Super Robot Story
A Super Robot story.
A Superhuman Family In Another The World?
A Superior Being Will Always Rise ... Even If They're A Goblin
A Sword Master's Travels (1)
A Sword Spirit's Journey in the Myriad Realms
A Sword's Nakama
A System To Kill Monsters?! I Just Want A Date For Prom!
A Tactician's Mind
A Tail's Misfortune
A Tainted Promise
A Tale From Azaad
A Tale From Azad
A Tale of a Certain Lolicon
A tale of a girl and her shadow
A Tale of Casual OPness
A tale of Might and Magic
A tale of nonchalance and tomfoolery...
A Tale of Peril: Change
A Tale of Sorrow and Love: Book I
A tale of teleportation
A Tale of the Elements
A Tale of Twin Moons
A Tale of Two Heroes
A Tale of Two Sisters
A Tale of Two Worlds
A Tale of Vengeance
A Tale of Villainy
A Tale of Winter
A Tale To Tell
A Taste for the Finer Things
A Technomaniac in Another World
A Ten Pound Bag
A Ten Year Vacation Turned Me Into A 14 Year Old Kid
A terrible field trip
A Theft Of Stars
A Thief's Tale: The Road To Redemption
A Thief's Tale: The Road To Redemption v1.826
A Thiefs Tale
A Thousand Faces: The Villain's Journey
A Thousand Year Old
A Thousand Years Queen
A Thread of Fate
A Time for Leisure
A Tingle Later: A Different Kind of Hero Tale
A Tinker's Damn - Book 1 of Descendants of a Dead Earth
A Titan's Crusade
A Toaster Story
A Tomb of Dead Stories
A Topaz in the Rough
A Towel to Save your Life
A Trace of Heroism
A Tragedy for a Demon Lord
A Train Between Worlds
A Traumatized Girl's Quest for Home in a Fantasy Land
A Traveler's Legend: Leisurely Living My Life In A Normal World
A Traveler's Tale
A Traveller's Journey; A litRPG Tale
A Traveller's Journey; A litRPG Tale. (part 1 complete.)
A Travelling Mage's Almanac
A tree's simple life
A Tribe of Kassia
A Truck Driver's Tale
A True Queen's Life
A Twist that Lead to the Fall
A typical fantasy Journey
A Typical Love Story
A Typical Xianxia
A Tyrant: Unshackled
A ugly swan
A Universal Tale
A Vague and Indistinct Existence
A vampire life
A Vampire's Dilemma
A Vampire's Journey in a Fantasy World
A vampiric Blade Reforged
A Very Autistic Post-Apocalypse
A very strange rebirth
A villainess Reborn
A Viral Life
A Virtual Invasion
A virtual reality game according to a martial artist otaku
A Virus Life For Me
A Vixen's Blood
A Void Spirit's Slightly Psychotic Tale
A Vorrgistadt Shard - The Shattered Oracle
A VR Story
A VRMMORPG Adventure: The Legend of the Legendary Rogue!
A Wanderer's Story by Dms143
A Wandering Dude
A Wandering to the Deep
A War Beyond Kings
A war for the ages
A War of Galaxies: The Things I've Seen
A War To End Them All
A Warlock From Elsewhere
A Warlock's Luck
A Warm Bed & A Hot Shower
A warm share of happiness
A Warrior's Love (BL)
A Way of Life
A Week to Infinity
A Weird Book #1
A Well Dressed Wolf
A Wheel Inside a Wheel
A Whisper Among the Stars
A Wicked Tale Of Witches, Wands, Booze, and Swagger
A Will and A Way
A Will of a Dragon
A Will to Recognize
A Wish For Power
A Wish in the Night
A Wish Of Change
A Wish Upon The Stars
A Witch out of Time
A witcher cultivator.
A Wizard of the past
A Wizard's Birth: Awakening
A Wizard's Life In a New Earth
A Wizard's Sacrifice, Book Two of the Woern Saga
A Wizard's Soul
A Wolf among Dogs
A Wolf In Penrith - A Kammi Kettu Story
A Wolf's Journey
A Wolf's Way
A Wonderful Adventure in a Wonderful New World
A World Away
A World Beyond
A world born from ashes (undefined hiatus)
A World Forgotten
A World in Chaos
A World In Motion
A World of Many
A World of Monsters
A World of My Own
A World Of Possibilities
A World of Summoned Heroes
A World Reborn
A World to Call My Own
A world travelers problem
A World Traveller
A World With My Destiny
A World With Nothing Normal
A World With or Without Aliens
A world with two moons
A World Without
A World without a System?!
A World Without a Tomorrow
A World Without Them
A World Worth Fighting For
A World Worth Protecting For
A Worldly Tale: Speechless
A Wrinkle in Reality
A writer's legend
A Yandere's Quest to Get Her Man
A Yellow Dress Forgotten
A Young Boy's Space Opera
A young girl is my master and I'm son of the demon king?
A Zombie's heart (BL)
A Zombie's heart (BL) - HIATUS
A(n) (Other)worldly Tale.
A-Live AI
A-Zero
A.I.
A.I. Actual Intelligence
A.R.K
Aarav - A journey with a Spirit in Another World
Aaron, A Shadow Monster
Aatrox, A God King in a Modern World.
Aavare
Abandon all hope by Darkmatter
Abandoned Card System
Abandoned: The Story About Ryu The Banished God
Abandoning All Hope
ABBADON (Naruto fanfic)
ABC – Ancient Beast Core
Abduction Chronicles: GENESIS
Aberrant
Aberrant Tales
ABERRANT: The Tale of Magic Under the Fallen Sky
Aberrant: Unbound Soul
Abigail the Grimoire
Ability
Ability to make a kingdom? Let's make a fast food restaurant!
Abnormal
Abnormal 2
Abnormal Boy Enters A New World
Abnormal Days
Abnormal Tamer
Abominable King
Abominable Standards
Abomination
About a dangerous girl
Above All
Above All Shadows
Above and Below
Above Heavens I Stand
Above the Fog
Above the Heavens
Absalom's Fate (The Everlands Book 1)
Abscondere
Absolute Control
Absolute Divinity (JJBA)
Absolute Knowledge
Absolute Order
Absolute Power
Absolute Power of the Imagination
Absolute Shopping Addict
Absolute Supremacy
Absolute Trinity
Absolute Zero
Absolution
Absolution's Road
Absorbed
Absurd Mage in Another World
Abyss "tomb of the gods"
Abyss Core
Abyss System
Abyss: A gamelit adventure
Abyssal Dragon: Awakening
Abyssal Fortress girl in another world
Abyssal King
Abyssal Road Trip
Abyssmal Downpour
Abyssus
Acacia Chronicle
Acadamia of Heroes
Academy of Heroes (The Murder of Innocence)
Academy Saint
Acadia: A LitRPG Adventure
Accidental Adoption
Accidental dungeon
Accidental God
Accidental Love Destined Betrayal
Accidental Merlin
Accidental Orc
Accidental summon
Accidental Time God
Accidental Warrior
Accidentally Blessed by a Goddess Before Reincarnating
Accidentally Smithing
Accidential dungeon
Acclimation
Ace of all Trades
Ace of Demons
Aced: A Slice of Life Tennis LitRPG
Aces From Hell
Achemist Dungeon
Acheron
Acolyte
Acolyte: The Emerald Gates
Acousat
Acrayma: The world that hates me
Across the border
Across the Realms
Across the Realms [Dropped]
Across the Stars
Action, Adventure, Videogame
Adam is the Protagonist
Adam's coin
Adam: The Archer
Adamant Doom
Adamantine Dragon in the Crystal World
Adamantine Heart
Adapt: The Scourge Wars Book 2
Adaptive Morphosis : Morning Sun
Addiction
Adelaide
Adeptaverse
Adeptaverse - Origins Of Altara
Adeptaverse - The Holy Calamity
Adermoor Cove Part 1: The Rainbow Beret
Admin Playground
Admin Playground - leave it be.
Admin Test
Adonis
Adonis:On
Adorne: (A LITRPG adventure)
Adorne: (A LITRPG adventure) (DROPPED)
Adrift
Adrift To Stranger Land
Adrift: Raven's Wail
ADT - Another Dimension Travel
Advent
Advent of a New World!
Advent of an Assassin
Advent of the Apocalypse
Advent of the Apostles
Advent of the Ascended [Dropped]
Advent of the Immortal Dream
Advent Of The Median
Advent of the Skeleton King
Advent Steel
Advent: Red Mage
Adventure Academy
Adventure From A Bard's Perspective
Adventure In A Foreign World - Legacy of The Chosen One
Adventure of a system supported gamer
Adventure of Adventures
Adventure of Chance
Adventure of Lara
Adventure of Luke
Adventure of The Eternal Brothers
Adventure Online
Adventure Party: Forest Crypt Campaign
Adventure Quest: Guardians of The Night Sky
Adventure to the Stars
Adventure With A System
Adventure? Slime? Slimeventure? Yeah, something like that.
Adventured away
Adventurer
Adventurer - Sunrise Over Sunset
Adventurer Academy: Greyblood
Adventurer Book II: Dawn of Discovery
Adventurer Hearth's Guide to Monster Taming
Adventures in a Shattered Worlds Beta
Adventures in amnesia
Adventures in Atalok
Adventures in Magic
Adventures in Mim
Adventures in Planus
Adventures in Red: Gunslinger's Follower
Adventures in the Pirate Continent
Adventures in Wonderland
Adventures of a Cicada
Adventures of a Fake Monk
Adventures of A God!
Adventures of a Reluctant Pacifistic Monster
Adventures of a young Zuma
Adventures of Alex Blackwell
Adventures of an avid gamer
Adventures of an Old Dreamer
Adventures of Branden Balond
Adventures of Lord Genesis
Adventures of one dude with an afro
Adventures of Percy Jackson in the MCU
Adventures of Ragnos
Adventures of Shadow and Garb
Adventures of Stephen Silworth
Adventures of the Bearmon Trainer
Adventures of the Blasted Marksman [Rewrite]
Adventures of the First Being
Adventures of the Goldthirst Company
Adventures of the moon
Adventures Of Truck-san
Adventures of Vee
Adventures of Zik Sev
Adventures on Patriam: Wolves and Men
Adventures on Terra: Beginning
Adventures With a Reincarnated Bush
Adventuring In A Unique Xianxia Universe
Adventuring in Another World
Adversary
Advice for Authors
Aefell Online
Aegis
Aegis Of The Gods
Aelin (title may change)
Aelios Online
Aenthar
AEO Alt Earth Online
Aeon Chronicles Online
Aeon Chronicles: The Frozen Calamity
Aeon Genesis: The Lord of Servants
Aeon Genesis: The Sin of Innocence
Aeonica
Aerid
Aerid: Tales Of The Academy
Aeromancer
Aeroth: The Arrival of the Beasts
Aesthetic of a Female Rogue
Aestia Valley
Aestral Online
Aeterna
Aeterna Saga, Volume 1: Walking With Giants
Aeternalis
Aether
Aether Academy
Aether Dragon
Aether Engineering
Aether Gate Online: Slayer (A LitRPG Saga)
Aether Hex and the shards of the demon king.
Aether Knight
Aether Online
Aether Online Archive
Aetheral Space
Aetherial Adventures
Aethermarked
Aethernea
Aetherworld
Aevalin and The Age of Readventure
Aevitas — I am not an NPC [R]
Affairs of the Soul
Affinity
After All
After Apocalypse: Silver Wind
After Days Chronicles: A Cabin By A Lake And The Things Beyond.
After Death
After death?
After Earth Online: The Iron Warlock
After Eons
After I Lost to the Demon King
After Kreation: A Widower's Tale
After Life
After Life?
After log 003
After Megiddo
After Megiddo: Hell's Pursuit
After Megiddo: The Book of Gideon
After Megiddo: Underrealm
After Moses
After the Fall and Other Stories
After the Fall. (Book 1 of the Shardfall Saga)
After the Game Over
After the Long Burn
After The Mountains Are Flattened
After the Tilt
After the universe exploded, I became a Dungeon Master.
After Worlds End
After Zero
After-Life
After-Life [Hiatus]
Afterdoom | The Post-Postapocalypse
Afterdoom | The Post-Postapocalypse (Complete~)
Afterlife
Afterlife - Next World's Auction House
Afterlife Hospital
Afterlife Industries: The Devil's Day Job
Afterlife Online
Afterlife Online: Reboot
Afterlife: A Gamelit Tower Story
Aftershocks
AfterWorld
Again
Again [On hold]
Again and again
Again from Scratch
Again?!!
Against all the Odds(hiatus)
Against Even Gods
Against My Fate
Against My Will
Against the Abyss
Against The Elements
Against The Flow
Against the Heaven's Will
Against the heavens.
Against the heavens. *Hiatus for trial*
Against the heavens. *Rework in release.*
Against the heavens. *Temporary Hiatus*
Against the Nine Great Heavens
Against the Sky
Against the World. Chronicles of melancholy
Againts all the worlds
Agartha (hiatus)
Age Is Just a Number.
Age of Aggression
Age of Avarice
Age of Champions
Age of Change
Age of Charon
Age of cultivation
Age of Cultivation Online
Age of Destruction *dropped*
Age of Divinity - Defender of Faith
Age of Divinity - Unleashed
Age of Gods
Age of Gods - A VRMMO Story [Dropped For Now]
Age of Gods Online
Age of Heroes
Age of Heroes: Novus Gaia
Age of Immortal
Age of Legends
Age of Others
Age of Regression
Age of Revolution
Age of Swordsmen
Age of Swordsmen Online
Age of Teras: Monster Evolution
Age of the Dungeon Hunters
Age of Victoria
Ageless Aneurin
Agenda of the Villainess
Agent Lightning: Operation Angel Arms
Agent of the Alternates
Agent of the Realm?
Agents of Dawn
Agents of MAGE
Agents of Stigma
Agents of the Lord
Ages Online
Aggro Healer
Aghori
Agnes of Raegma
AGON: Trail by Champion
Agordos
Agorɔ
Agros de Mortis
Ahead of the Patch
Ahh so it's another dungeon story with a long name
AI Dungeon
AI Immortal God Soul
AI's Champion
AI: Revolution
Aim and Fire
Ain't A Hero
Ain't no Rest for the Wicked
Aincrad Realized
Aino and Eien
AinSlay
Ainōryoku Sentai Nightmærangers
Airant
Airbound
Airi
Airi in a Thousand Worlds
Airium - Beta key
Aivuez: The One Being Brought to Lullaby
AK - The Alchemy Kingdom
Aka
Akashic
AkaTsuki: Book One [The Heart of A Samurai]
Akhand : The Demon Emperor
Akif Kas - Champion of the Arena
Akuma Karu
Akuma No Kage
Akuma no seifuku no fukushū?
Alamat (Legend)
Alaric Castle
ALARIC CASTLE: Becoming the Best Boss Level
Alarm! Colony under attack!
Alaska 66 MYA (A Grant Foreman Adventure)
Albert's Summer
Albion Live
Alcaim Saga
Alceria
Alctuz Arena
Aldemoor
Aldenia: The Lost
Aldernoh
Alea Ludo
Aleri The Return
Alex Brim, Hero for Hire
Alexander Nightmare
Alexander's Deviant Vanguard
Alexis Longbottom and the New Age of Magic (Harry Potter AU)
Alfarome: Volper
Alfegenia-Inline
Alfheimr Renaissance
Alfirima Fea
Aliad - Tale of Zed [Dropped]
Aliad [Dropped]
Alice
Alice Devil Gift
Alice In Madness
Alice in Magic Land
Alice in Magic Land [UNREVISED]
Alice The Roaming Dungeon
Alice's Saga of Fire and Blood
Alice/Zero
Alice: Conquering Nightmare
Alien Abduction: A LitRPG
Alien Me
Alien Witch
ALIEN: Otherworld
Alien: Tribulation
Aliens in a fantasy world (AvP fanfic)
Aliens vs The Elvish Empire
Aliens! Tech! War! OH YES!!
Alistair's Great and Powerful Startup Dungeon
Alistair's Legacy
Alistair's Legacy (Currently under rewrite)
Alive
Alive ?
Alive bond
Alive, once again
Alive?
All
All Accounts Cleared (Novella)
All Alone with You
All Because of a Serum
All Because of a Serum: Batch 1
All Days Shall Be Numbered ; A LitRPG
All Encompassing
All In One
All In One Anime
All into Agility
All Mine
All of The Angels
All Out of Time
All Songs: A Hero Past the 25th
All Stats Random
All systems rise to power.
All Things Must End
All Time Greatest Genius
All Trades Book 1: Master of None
All World Online
All Yesterday's Parties
All's Fair in Love and Demons
All's Fair In Love&War
All-Powerful
All-seeing
Alland
Allister Hale's Story Graveyard.
Allocation
Alluring Smile (Yāoráo De Wéixiào)
Almagear
Almagear (V2)
Almave
Almavé
Almighty Dung
Almighty Dung [Dropped]
Almighty Hunter
Almighty System
Almisha's Journey
Almost Grimm
Almost Heaven; A VRMMO Story
Alomiriya
Alone
Alone at my Destination- a Record of Climbing the Unending Tower
Alone No More
Along for the Ride
Alpha
Alpha - Book 1 in the Jaro Trilogy
Alpha Armageddon
Alpha Curio
Alpha Physics - Post Apocalyptic
Alpha Physics - Post Apocalyptic LitRPG
Alpha Squad - Vecto: Vengeance
Alpha: Amaryllis
Alphas & Omegas [Dropped]
Alt Atelier
Altar Ego
Alter Online: Oathkeeper
Alter Tactics
Alter's Aburd Escapades!
Alter: Eclipse| The Chronicles of Gacaea | Book 1
Alteratio
Alteration
Alterea: The JoaT
Altered Realms Book 1: Inauguration
Altered Realms: Ascension [completed] - Book 1 - A LitRPG series
Altered Realms: Book 2 - Uprising - A LitRPG series
Altered Realms: Origins
Altered Tales
Alteria: The Fall of Gods
Alterlife
Alterlife II
Alternate (Naruto FanFic)
Alternate 2020
Alternate Dreams
Alternate Earth Alternate timeline (DC)
Alternate Eyes
Alternate World Online
Alternative Berseria The X (アルタナティブ・べうセリア・ザ・クロス)
Alternative Reality Vol. 1
Alternative: Indigo
Alternative: To Love–Ru
Altrea: New sights from another world
Alviona (undergoing Rewrite).
Always and Forever
Always Name Your Tools
Alyx: the shifters tail
Alzholme
Am Ende mit meinem Latein
Am I a capture target in a otome game?
Am I a Goddess now?
Am i a goddess? A devil? No i am a lizard
Am I a goddess? A devil? No, I am a lizard
Am I Lewd Enough?
Am i spoiled?
Am I The Creator Or The Destroyer?
Am I The Only One Who Is Not Forced to Migrate Across Worlds....?
Amalgam System
Amalus
Aman
Amaron Online
Amazing Cleavage: The Adventures of a Battle Axe
Ambassadors to another world
Amber
Amber Silverblood
Amber Silverblood: Silverpack
Amber the Goddess of Time
Ambidextrous
Ambiguous
Ambition
Ambition [Indefinite Hiatus]
Ambitions of an Immortal
Ambot sa langaw pilay idad sa ok-ok!
Ambush (DarkForce: A GameLit Saga - Book 1)
Amending of the 'Evil' Pair.
America Appears in Another World
America In Another World
America's Knight
Amethyst Phoenix
Amidst the Final Sky
Amie, Android
Amnesiac
Among Demons and Gods
Among Giants
Among Monsters and Men
Among the Dead
Among The Stars
Among the tear soaked flowers
Amongst the Sky
Amongst the Stars
Amulet of Infinity
Amusement Park
An 'Ordinary' Adventure
An A.I Is Such A Cheat In The Martial World!
An Abnormal Kobold
An Above Average Girl In A Fantasy World
An Academy for Villains
An Account of Some Strange Happenings in Burdock
An Advance in Time
An adventure begins
An Adventure Beyond Greatness!
An adventurers tale
An Afterlife Odyssey
An Age of Fire and Blood - Volume 1: Unravel
An AI in Eden
An Aircraft Carrier in a Fantasy World
An Alien in Wonderland
An Animal in Sheep's Clothing
An Anime Weeaboo in a Different World [Hiatus]
An Anomaly's Life Inside A Galge is Seriously too harsh for me!
An Anthology
An Apex Supreme Master Running A Library Filled With System
An Apprentice's Adventure
An Aquila lost within an Oriental Land of Illusions
An arachnids way to Niflheim [HIATUS]
An Argonaut's Odyssey
An Aria of Fire and Blood - Volume 1 - Kismet
An Artificer's Ambition
An Atomic Choice (A Working Title)
An Atypical dungeon
An author's massacre; the sudden appearance of the world, and its immediate cry
An author's new view
An average adventurer.
An Average American in A High-school Academy Anime
An Average Joe Is the MC
An Average Zombie's Path of Evolution
An Edge With No Blade
An Edgy Tale Of An Edgy Teen
An Egotistical Heretic's Reincarnation Doctrine
An Eldritch Tale: the Archwizard's Tome
An Elven Druid's First Adventure
An Empire of Fire and Magic (The Chronicles of Pavel Maveth - Book Two)
An Empire of Shadows
An Empire Reborn (A Rebirth of Empire Series: Book 1)
An Empire Reborn (A Rebirth of Empire: Book 1)
An Empires Rising
An Empty Throne
An Enchanter's Tale
An Ent-Like Existence
An Eternity Gone By, To Learn To Live
An Everyday Journey
An Evil Hero
An Evil Justice
An Excuse for Space Battles
An Exile's Journey
An Exploration of Vulnerabilities
An Extra-Ordinary Story about Ordinary People
An Id of Primal Chaos
An Identity Beyond Self
An Identity Beyond Self (LN)
An idiots Guide to Creating a Universe
An Idle Drone
An Immortal Tale
An Immortals' Interaction with Modern Technology.
An Inconvenient Flame
An Indomitable's Odyssey
An innocent storm
An Interesting Journey
An Introduction to Being a Goddess
An islander's Meta-journey
An Minecraft Adventure
An NPC Challenges the Dark Lord(LN)
An NPC's Path: The Dead Rogue by Pavel Kornev
An Ode to Swordsmen
An Ode to the Birds
An Old Cultivation Record
An Old Man's Journey
An Old Man's Journey Vol 1 & 2
An old man's new world
An old mans tale!
An Old Villian's Tale
An Omnibus of Heroes
An ordinary novel but every 10,000 words the audience kills the least interesting character
An Original Transformation
An Otherworldly Smile
An Otherworldly Tale
An Otherworldly Tale: A New Dimension
An Otherworldly Tale: The Apocalypse/A School Saga
An Otherworldly Tale: The Girl
An Otherworldly Tale: The Guild Moroides
An Otherworldly Tale: The Story Of Swords. The Ark Arc.
An Outcast In Another World (Subtitle: Is 'Insanity' A Racial Trait?)
An overly OP MC in another world.
An Un-Ideal Eternity
An Unbound Soul
An Uncertain Duality
An undead's adventure
An Undying Coward in the Apocalypse
An Unexpected Adventure
An Unfamiliar Summon
An Unhinged Author
An Unidentifiable being even by God enters a fantasy world
An Unknown World
An Unlikely Haven
An Unthinkable Life From The Last Eternity
An untold tale
An Unusual Town
An Unwanted Dragon
An unwelcomed and unwilling hero
An Unwilling Monster
An Upgraded Soul
Anachronism
Analyst Advancement! (A LitRPG Adventure)
Analytic System in Another World
Analyze, Create, Control In Another World
Anaraknakrium: The Cursid
Anarcho: A Gamelit Cyberpunk Fantasy
Anarchy
Anarchy in a Deranged World
Anarchy's Dungeon
Anathema of the Eldritch
Anathum: Quest for the End
Anax
Ancestor, Wake Up! (Xianxia novel)
Ancestral World: Memorial Clouds
Ancestry: The 1/64 Orc, The Quest and The Status Screen.
Anchore
Anchore (Re-Write in Progress)
Anchored
Anchorkin
Anchorkin [Rerwiting]
Ancient Adventurer Return
Ancient Array Master
Ancient Blood
Ancient Blood - book 1 The fall of the Phoenix
Ancient Blood Mage
Ancient Cultivator in Modern World
Ancient Dragon of Chaos [Spanish]
Ancient Earth
Ancient Fangs: Birth
Ancient Fangs: HOUSE AMULIUS (Book 2)
Ancient Mana Dungeon Core.
Ancient Return
Ancient Ruler [ XIANXIA ]
Ancient Sins
Ancient Sovereign
Ancient World
Ancientblood
Ancients
Ancients [An Epic Litrpg]
And Dungeon Makes Three
And far was the walk.
And Justice For One
And So It Starts
And So We Leisurely Walk
And the world breaks
And then I made my own world
And Then You Left
And Thus, We Hoped
And You Thought Your World Was Harsh!
Andraste
Andraste's Chevalier
Andrea's Tale
Andromeda's Tears
Andur's Oneshot collection
Anemoia
Angel and Wolf
Angel and Wolf: Chronicles
Angel and Wolf: The Fury
Angel of Colors
Angel of Death
Angel's Ascension
Angel's Dirge
Angel's Ladder
Angel's Redemption (BL)
Angel's Song: Requiem of the Dreams
Angelborn
Angelic adventures
Angelic Knight Of The Mighty Zealot
Angelic Quest
Angelica the Techno Ghoul
Angels Without Wings
Angie
Angry Dungeon
Angry Moon
Anilink
Anima
Anima Adrift
Animal Lord
Animalis Circumplexus
Animated
Animated World: Drawn In
Anime Apocalypse
Anime Clichés 101
Anime Dungeon
Anime Girls From Another World
Anime of You: Traveling to Other Worlds
Anime powers in the Naruto world
Anime wheel of fortune
Anime World?
Anime Worlds System
AnimeCon Harem
Animus
Animus Smith
Animus Storm
Anna'dalia
Annals of the Snow Prince
Annihilation System
Annihilation's Impact
Anno
Anno 223
ANNO DOMINI ~Allium~
ANNO DOMINI ~Allium~ [Beta version]
Anno Iudicio
Anno Monstrum (Year of the Monsters)
Annotated By Sins, Magic Academy
Annwyn Online
Anoikis
Anointed in Blood
Anomalous
Anomalous: A Contemporary Reality-Bending Adventure
Anomaly
ANOMALY ; Lost souls (dropped)
Anon: Goddess of Anonymity
Anonymous Demonic Angel
Another Apocalypse Story
Another Chance
Another Chance (Dropped)
Another Chance (Hiatus Indefinitely)
Another Chance in Life: I am Alive Again
Another Day
Another Day, Another Quest
Another Dungeon Report
Another End
Another Failure
Another Fantasy (Canceled)
Another Game
Another hero Tale: Nephilim
Another Isekai
Another Isekai Story
Another Isekai Story!
Another life (Loks123)
Another life another chance
Another Life as a Bastard Pro Player
Another Lit-Rpg
Another Me, But Cuter
Another Naruto Fanfic (Not For Fun)
Another Novel with OP MC
Another practice
Another Regurgitated Piece of Garbage
Another Reincarnation
Another Summoned Fantasy
Another Terror Infinity Fan Fiction
Another TI Fan Fiction
Another Vampire Story
Another World
Another World (Straightforward title, aye?)
Another World and I'm still rich?
Another World Online
Another World Priest
Another World Trip: Journey with My Cat and an Otaku Loli Goddess
Another World Trucker
Another world with the Bleach System
Another World with the Omni System
Another World With The Skyrim System!
Another World's Devil-Queen
Another World's Hero
Another World's Homunculus
Another World's Trespasser
Another World: Scientist
Another World? Never Saw This Coming
Another world? Some weird magic? Sure.
Another world? what's the difference?
Another You
AnotherWorld (hiatus)
Anshina The Forbidden world
Ant in Magic World.
Ant King
Ant Lord
Ant Lord: Monsters in the Fog
Ant Tensei (Original) and (Redux)
Antagonist
Antagonist Rewind
Antagonist's Sidekick Becomes the Hero!
Ante Portas
Anti-Hero: Journey of Fear
AntiGod
AntiHero
Antithetic: Spire of Wonder
Antlin's Prophecy
Antomea's Chronicle - Nina
Anxiety and the Beginning
Anya
Anyhorr
Aoi
Aoi - Part 1
AOT: The Magic Tower.
Apathetic Hero (working title)
Apathetic Transition
Apathy
Apex Code
Apex Code [REWRITE]
Apex Legend in Another World [Litrpg/Dungeons]
Apex of Creation
Apex Predator
Apocalypse
Apocalypse 2020: Look to the Skies
Apocalypse : A New Dawn
Apocalypse : Judgement's Day [Rewrite]
Apocalypse Arcana - The Devil
Apocalypse at Mighty Max
Apocalypse Born
Apocalypse Boy
Apocalypse Enchanter
Apocalypse ending world
Apocalypse Evolution
Apocalypse Express
Apocalypse Games - The Rule of Three
Apocalypse Hero
Apocalypse Hero - (Deletes July 1st)
Apocalypse in Russian style
Apocalypse Incoming: Take two
Apocalypse Man
Apocalypse Meltdown
Apocalypse Now
Apocalypse Now (Hiatus)
Apocalypse Now: Under Contract
Apocalypse on Endless Earths: Apocalypse How? A LITRPG Adventure
Apocalypse Override: Zombieman
Apocalypse Please(?)
Apocalypse Post
Apocalypse Rebirth
Apocalypse redone
Apocalypse Remnant
Apocalypse Remnant`
Apocalypse Respawn
Apocalypse Simulator
Apocalypse Start
Apocalypse Step
Apocalypse Ted!
Apocalypse The Fantasy
Apocalypse Unleashed - A LitRPG Story
Apocalypse war
Apocalypse War: Survive. Die & Restart
Apocalypse War: Survive. Die. Restart
Apocalypse War: Survive. Die. Restart (expired version)
Apocalypse War: Survive. Die. Restart (OLD version)
Apocalypse War: Survive. Die. Restart (Reborn/Seconde chance - litrpg)
Apocalypse War: The Return of the Last Demon Slayer
Apocalypse Wishes
Apocalypse Wow
Apocalypse, Sounds Like Fun
Apocalypse: Generic System
Apocalypse?
Apocalypse? No, it is heaven!
Apocalypse? Paradise.
Apocalypse?it was my snack
Apocalyptic Evolution
Apocalyptic Paradise
Apocalyptic Survival- How to survive the Apocalypse -
Apocalyptic Trifecta
Apocalyptic World, Cheat
Apocalyptica: Vector's Edge
Apocalyspe ending world
Apoch's Twilight
Apocrypha of The Dead
Apollyon, The God of Chaos.
Apology of a Cold Heart
Apostate Konstantin
Apostle
Apostle of Sin
Apotheosis - The Dungeon of Kess
Apotheosis - The Man Clad in Black
Appetite! [BL]
Appetizing Magic
Appless
Appolon
Appreciate Human.
Apprentice of the Void
Approaching Ascension (Book 1)
Approaching Fate
Aqua Requiem Bloodlines
Aquaria
Ar'Kendrithyst
Arachnid Kid?Boy?Teen?
Aragons
Arain
Arashia: A LitRPG story
Aratana hajimari (VRMMO)
Arawulf, the First Daughter
Arbiter of Power (Canceled and currently redone as 'Re:' version.)
Arborea
Arc a New born titan [suspended]
ARC. Survival Online
Arcade Warfare in Another World
Arcadia
Arcadia Chronicles: The Story of Lien Hua
Arcadia's Ignoble Knight
Arcadia's Reach
Arcadias Moon.
Arcadis Park
Arcana
Arcana: The Rebel King
Arcane
Arcane Army
Arcane Cycle
Arcane Engineer - The Awakened Dungeon
Arcane Engines: Alchemist's Scheme
Arcane Evolution
Arcane God Marcus
Arcane Power
Arcane Regeneration
Arcane Societies
Arcane Summoner
Arcane Survivalist
Arcane Transmogrification (Book Two of the Pentacle Series)
Arcane Wonders
Arcane's Heart
Arcanist
Arcanist Warlord
Arcflame, the strongest tree-growing dragon
Arch
Arch Magus, The Wich Hunter
Arch, Inc. - Secret Origins
Arch-Mage? Arch-Warrior? Why Not Both?
Archage
Archaic Avalon
Archaic Princess
Archaic Records
Archaic Transmogrification (Book Two of the Pentacle Series)
Archangel
Archangel: Angels versus Angels
Archangel: Breaking Orbit
Archillies Duane : The World Traveller
Arching Choices
Arching Choices 1.2
Architect of Dominion (The Darius Kane Chronicle)
Archive - shapeshifters boredom
Archive of James: Origins.
Archmage Awakening: a Hunter Becomes a Mage
Archmage Father
Archmage Paladin
ArchMagus
Archon
Archonlight System Genesis
Archwizard's Tales: Book One
Arclight Online
Arduous New World
Are you a Lucker? (Luck based LitRPG)
Are You For Real!?
Are you worthy to Join my party
Area 51
Arena
Arena Earth
Ares
Ares' Witch
Argent Dawn (DROPPED)
Ari
Ari-os
Aria - The Pulsar Chronicles
Aria of Memory
Aria of the Fallen: Adventure in a Foreign System
Aria of the Sun and Moon
ARIA Online
Aria Wanderlust
Ariair Online
Arianna's Wish
Aries
Aris Cretu
Arkan
Arkan Collection
Arkandia
Arkhay (Writers block on this story..Sorry guys. might never add more)
Arkund - Terror in the streets
Arlec
Armada
Armageddon Online - Escape
Armageddon: A Biography of a Forgotten History
Armageddon: A New World
Armbuster
Armor Corps
Armor of Justy (AoJ)
Armored
Armored Prayers
Armorling wants to be a king
ArmourXDemons
ArmS: The Last Human [dropped]
Army of one
Army Of One (Pokemon Fanfic)
Army of the Fallen
Arnar the Dungeon
Arowne'S Rebirth
Arpeligo
Arrested Alterings: A Genetic Detective's Hunt for Answers
Arrogance is justice!?
Arrogance: Lost reports
Arrogant Master In The City
Arrogant Young Master Template A Variation 4
Ars
Ars Alogia
Ars Arcana
Ars Remnants
Ars Utopia: A Fantasy Dystopia Story
Ars: The World Beyond The Walls
Arsenals of Ephilor: The Rising Fire
Art of Alchemy
Art of Mortality
Art of Poison
Art of War
Art Sword Online | アートソード・オンライン
Artanis Road
Artemis The Celestial Beast(Hiatus)
Artfin, Power Money and Woman [Dropped]
Arthron ~It seems I become a newbie god~
Arthropod Online
Arthur
Arthur "The successor of the god of time"
Arthur and the Mystery of Reincarnation
Arthur ReD
Arthur...but the draft
Artifact: Mila
Artifice: Iysinfyr
Artifice: Tools of the Gods
Artificer
Artificial Biological Runic intelligence
Artificial Devastation
Artificial Fantasy
Artificial Jelly
Artificial Light
Artificial Mind
Artificial Seed
Artificial Selection
Artificial Selection: A Near Future Thought Experiment
Artificial War
Artificial Yuusha
Artisan
Arts Master
Arum: Reconquering the Dungeon World
Arun Online [Dropped]
Aruna
Arx Speculo
Arzhel's Magic Tavern
As a Dungeon
As an Isekai fanatic in another world : The chronicals of Mikhail and Ernesto
As Crônicas dos Últimos Leanfis - Furor da Magia
As Lightning Falls from Heaven
As Long As It'S Interesting, Isn'T It Fine To Live As A Dungeon?
As Long As It'S Interesting, Isn'T It Fine To Live As A Dungeon? (Hiatus)
As the Godking Wills
As The World Catches Fire
As The World Spins
Ascend Online
Ascend to Be GOD
Ascendance
Ascendance of a God
Ascendance: A Tower Story
Ascendance: Rebirth of the Unknown Gamer
Ascendancy
Ascendant Legacy
Ascendant of Air
Ascendant Online: A LitRPG
Ascendant: Online | Book One | Witness the Beginning
Ascendant: Online | Book Two | Crash Through
Ascendant: Online | Crash Through
Ascendant: Online | Witness the Beginning
Ascended
Ascended Dark Sovereign
Ascenders Rift
Ascending
Ascending Hero
Ascending The Heavens
Ascending Trinity
Ascension
Ascension Alphas
Ascension Core: A Cyberpunk Story
Ascension From Nothing
Ascension of a Reborn Woman
Ascension of Madness
Ascension Of Moba Gamer
Ascension of Shura
Ascension of Singularity
Ascension of the Evil God
Ascension of the Godly Assassin
Ascension of the Strongest
Ascension Online
Ascension Rebirth [Dropped]
Ascension To Brutality
Ascension VR
Ascension: Rise of the Crimson Wizard
Ascension: The Coming Storm
Ascension: The Helm of Lentha
Ascent
Ascent [Discontinued]
Ascent of The Enchanter
Asd: A Werelion's Journey To Arcane Supremacy
Asgard's First Elemental Necromancer
Ash
Ash and Bone
Ash Burst
Ash Risen
Ash. The Legends of the Nameless World. Progression Gamelit Story
Ashen Essence
Ashen Ghost
Ashen Lord
Ashes
Ashes *Hiatus*
Ashes and Cinders
Ashes dungeon
Ashes of Creation
Ashes of Empires
Ashes of Eternity
Ashes of Gods
Ashes of Gods: Return of the Blade Emperor
Ashes of the Arctic
Ashes of the New World Book 1: The Light Burns the Gentle Shadow
Ashes of the Primordial
Ashlyn's choice
Ashrennon
Ashura Vale
Ashura, Heir Of Rebirth
Ashura- The Demon Sovereign
Asiad the land of lords
Asleep - A LITRPG story
Asmundre
Aspect of the Beast
Aspect of the Forsaken
Aspect Online
Aspects of Heaven and Earth
Aspects of Nature
Aspiring Demon Lord
Assassin Alonne
Assassin Gamer [HIATUS]
Assassin God
Assassin or Princess? Why not both.
Assassin Type: The Rifle Girl- Rica Reyes
Assassin's Child
Assassin's Decree
Assassin's fate
Assassin's Revival
Assassination Highschool
Assassination System V.2
Assassins and Generals
Assassins Who Cleanse Sins Away (Alternative Title: The Sweepers)
Assault The World
Assimilation
Assorted Writings
Asteria Anthology
Astin
Astlan's Ira
Astoerith Online
Astora's Paradox
Astra Fabulam
Astral Arcana: Ethereal
Astral Bridge
Astral Connections
Astral Dungeon
Astral Fate Part 1: Starlit Brawler
Astral Land
Astral Land : The Beginning of Everything
Astral Projection
Astral Royale Chronicles
Astral Son
Astral's Oubliette
ASTRAL: Awakening of the Saffron Sky-Tamer
ASTRAL: Rising
Astralfice
Astralis Lumen
Astrayed Absolution
ASTREA - A Game of Different Realities
Astrid Vs. The Asteroid
Astro Dog
Asunder Online [DROPPED]
Asunder Online [Indefinite HIATUS]
Asura
Asura [Bleach]
Asura Ascending
Asura Swiftblade
Asuras and Dragons **Indefinite Hiatus**
Asya
Asymmetric Warfare
At Death's Door: Legacy
At the End of the Evening
At the End of the World
At The End of the World (Old Version)
At The Fields of Fire and Blood
At the Top of the Food-Chain
At Wit's End
Ataraxia Sanctuary
ATCS Ability to Change Size
Atemporal Chronicles - Commencement Tale
Aterheim
Aterheim [DROPPED]
Athanatos
Athanor
Atk 0 Crit All ~My attack stat is negligible, so I can't help but rely on critical hits to succeed!~
ATL: Stories from the Retrofuture
Atlantean Mage
Atlantis
Atlas Code
Atone Online
Atonement
Atonement of an Immortal
Ator
Atreo "The Delusional Demon Prince"
Atros Imperium
Attached
Attack on Titan: Reed Ackerman
Attack On Titan: The Peace, I Desire
Attuned
Audacity Light
Audea's Seal
Augmented Reality
Augmented: Dot Project
Augmenting Reality
August Ace
Auntie toasts the VRMMORPG
Aura of Magic
Aurelia Online
Aurelion
Aurion: The New World
Aurora
Aurora Eclipse
Aurora Scroll
Aurora's Sky
Ausfagner: The First Exogenous
Auspicious Apocalypse
Author Rebirth To The Douluo Dalu World
Author sent into his own story, now what do I do?
Author Vs Protagonist
Authority
Authority [Dropped]
Authority Fought For -- A Simple VRMMO Story
Authority: The Prequel
Autist Isekai
AutoDot
Automata Annex
Autonomous Machine Arsenal: An Evil Machine's War Record
Autumn Grim
Autumn to Winter
Autumn Winds and Crimson Waters
Avalon
Avalon'S King
Avalon's Shards
Avalon: New settlers
Avalon: The Hell Mode of the Universe
Avant Garde
Avaria: A Pay To Win Adventure
Avaritia
Avast Online (DROPPED)
Avatar of Humanity
Avatar of Nature: The Enchantress
Avatar: The Legend of Percy
Avatar: The Wild Lands (A Medieval 'Avatar: The Last Airbender' Fiction)
Avatars
Avatars of Myths and Legends
Avaunt
Ave Akakios
Ave Xia Rem Y
Avenger
Avenger Of Destruction
Average Slime
Averno
Avery
Avescar - Adventures of Kiyu
Avian | Krieg der Welten (German!!!)
Avine: The Journey
Avitus Volten's journey through space and time
Avoiding the Heroine and Capture Targets!
Avonlea
Aw Cluck
Awaiting Integration (A.I.)
Awake
Awaken
Awaken Online
Awaken Online - Conception (A FanFic)
Awakened Cheater
Awakened in a New World
Awakened Soul, Book One: The Deep Hollows
Awakened Warmonger
Awakened; Dungeon Tales
Awakening
Awakening (A Necromancer's Revenge)
Awakening (The Necromancer's Legacy)
Awakening Chronicles
Awakening in Ruins
Awakening of a Heart
Awakening of a Monster
Awakening of an Anomaly
Awakening Of Moba Gamer
Awakening of the Unknown
Awakening the Stars
Awe, come on man, really, Again!
AWE: Adventures of a Reincarnated Noble Android Girl (Rebooted)
AWE: Ballad of 3rd Crown
Awful garbage
Awti
Axe from North
Axiom
Ayla's Junkyard
Aylee
Aytelia
Azalea
Azalon
Azarinth Healer
Azeal Neralum
Azel's Dream World
Azeria: The Era of Black Flowers
Azran - Magic King of the Darkness(Finished Volume 1/Dropped Volume 2)
Azura of The White
Azura the Slayer
Azure Lineas: The Blue Line
Azure Tale
Azure Warrior
B
B's Grand Adventure
B-But I don't WANT to be a protagonist!
B.L.A.N.K- The search for the meta
B.U.D
B1nary Bl00d
Babel
Babel - The Path To Ascension: Heaven
Babel - The Path to Ascension: The Golden Children
Baby, I Love You
Bacis: The Land of the Gods
Back Again
Back to Day One (On Hiatus)
Back to Pokemon and Earth
Backyard Hero
Backyard, cute cat eared girl changing her clothes, spirit magic to make breads and saving the world
Bacterium
Bad ass Bunny - A lack of common sense isekai for no reason.
Bad Company
Bad Habits {New!}
Bad Habits {V2 Out now!}
Bad Harem
Bad Intentions
Bad Light Era
Bad Luck
Bad Luck World
BAD: Born A Demon
Badass
Bag Boy: Adventures in Super Crime.
Bakemono: Redemption
Baking Bread
Balada: When death did not exist, nor yet Eternity Part I
Balance
Balanced
Balancer-Shattered Soul
Balancing of the world
Ball of Light: Specialization
Ballad of Failure
Ballad of Mortals
Ballad of The Clay Golem
Balthazar, a case study
Band of Heroes
Bandit Host Club
Bandit King
Bane Blood (On Hiatus)
Bane of Ashkarith
Bang : reincarnated as parrot
Bang Ding Ow
Banned From Existence
Baphomet the Destroyer
Barakdor
Barbarian Game
Barbarians
Barbaric beginnings
Barbearian
Barkept
Barrow of the Lost
Barter System (or BS like BullSh*it)
Base Affection
BASE Status: Online
BASE Status: Online [An Unlikely Hero's Journey]
BASE Status: Update (BASE Status 2)
Based on a Life
Basically Yaoi, But With Ninjas.
Basra
Bastard Assassin (18+)
Bastard's Crown
Bastard's Wrath
Bastion Academy Book 1 - Foundations
Bastion Academy Series
Bathilda the Bat
Batman and Spider-man: Year One
Baton
Battle Academia: Mediocre Martial Artist
Battle Avatars
Battle City: Rise Of The Blue Spark
Battle for the Photon Core [Inter-Universal Protectors: Book 3]
Battle Hardened
Battle is an Art
Battle Maiden
Battle Maidens
Battle Necromancer
Battle Necromancer Version 2
Battle Necromancer Version 2 - Hiatus
Battle of Blackfortress
Battle of Lexis
Battle of realms
Battle Of Supremacy: Heroes and legends
Battle Royale across the Universe: The Species Tournament
Battle School
Battlebond
BattleCube
BattleField - A Never-Ending Nightmare
Battlefield Reload
Battlefield Restart
Battlefield Restart (Dropped)
Battlefield Restart (Edited)
Battlefield Restart (Old Version)
Battlefield Restart 2- An Adventure Beyond Greatness!
Battlefield Restart 3- An Ascendance Beyond Destiny
Battlefield Restart [Reboot]
Battlefield Restart- An Identity Beyond Self
Battlefield Restart- An Identity Beyond Self (LN)
Battlefront
Battlegrounds Of Celestial Beings
Battlemaster's Gambit A LITRPG Monstergirl Harem Adventure
Battlesquire Book I - First Blood
Battling for Survival in a New World (On Hiatus)
Battling Records of the Chosen One
Battling the World
Bay City Runaway
Bayani
Be a man, be a hero
Be a Steam Player
Be The Icy Beauty: A Xianxia/Cultivation Tale
Beach Bum
Beacon in the Dark
Beanstalk
Bear Maid the Princess' Guardian
Bearer of the First Flame
Bearer of the Red Lotus
Bearer of Time: Haze
Beast
Beast Cultivating System
Beast Dao Cultivator
Beast fiend
Beast Games
Beast God
Beast Knight
Beast mage
Beast Master System
Beast Mutation
Beast of the Mountains
Beast of the Night
Beast Queen: A LitRPG/GameLit Action/Adventure (book two of Monster Slayer Online).
Beast Slayer
Beast Tamer
Beast Tamer Kayne
Beast-Men
Beastborne
Beastborne (An Isekai LitRPG)
Beastkin of GRIM
Beastly - Screw being human . . . they suck anyway!
BeastMaster Zero By justTYM
Beastmastery - A LitRPG Novel
Beasts & Bastions
Beatrice Santello
Beauty of a Chrysalis
Became the Strongest Cultivator Just By Existing
Because I do not fit well with my life, I am given a restart!
Becket The Elf?
Become God
Become Immortal
Become Strong!
Becoming
Becoming a God
Becoming a Hero
Becoming a Hero (Portal Fantasy LitRPG)
Becoming a mesiah
Becoming a Vampire in The Space
Becoming God
Becoming Itachi Uchiha in a Different world!
Becoming Legend Companion PokeDex
Becoming my rival's love interest!
Becoming Renegades in Another World!
Becoming The Horror
Becoming the Protagonist of My Own Delusional World!
Becoming The Wolfman
Bed of Glory "Conqueror of all Worlds"
Bedlam - A litRPG Novel
Bedrock 岩盤 Ganban
BEEADDLEDRUNG ⁠— Serial Bogeyman
Before a Legend
Before Butterfly Effect
Before the Day Is Done
Before the Fall
Before The Hills
Before They Came
Before They Came (Magical Apocalypse)
Before Your Heart Cries
Before:After
Begin the End
Beginners Guide to Dungeoneering
Beginners' Guide to Dungeoneering
Beginning After The End
Beginning Of Arcadia, Chapter 1: Home
Beginning Of Reality
Begsissbbdd
Behemoth
Behemoth - HIATUS
Behemoth hunters
Behind Your Smile | 你的笑容
Behold the Bacterium
Being
Being a Bystander is the Best
Being A Divine Salamander Is Not So Bad
Being a side character in a romcom
Being A Side Character IS Hard In The Apocalypse
Being an adventurer is harder than it looks!
Being chased by the heroes because I am a Master Puppeteer.
Being Frank
Being God is Fun
Being Human (Completed)
Being in the Grey : Awakening
Being the God of Hell is a bother
Being the God of Hell is a bother [On temporary hiatus]
Being Undead
Bellona the Heartless
Bellwether
Bellwether 1
Bellwether 2
Beloved Protection from a nine tailed fox
Below The Distant Sky
Ben the Dungeon
Ben's Damn Adventure: The Prince Has No Pants
Bend
Beneath the Dragoneye Moons
Beneath the Fallen City
Beneath the Iron
Benjamin
Benjamin's Account of Adventures
Benji and The World Spike
Berserker of the depths
Berserker- Crank Wars
Besotted
Best Friends Forever?
Beta Life, Digital Sorcery Book 1 (A LITRPG Adventure)
Beta Test
Beta Testing for Implementation of Status and Power
Beta World
Beta Zero
Bethrothed to the Royal Twins
Betrayed by Light
Betrayed by Light - Complete Book 1
Betrayed in a Blessed World (Web Novel)
Betrayer of Humanity
Betsu no Sekai de Muteki O Sokushin Suru
Better Days
Better Than Life
Better than one
Better To Be Lucky Than Good.
Between Mountains and Moons
Between the planes
Between War and Magic
Between Worlds
Beware Of Chicken
Beware of the Synthetic Siblings
Beware of Zombies
Beyond
Beyond Average [LitRPG + Dice]
Beyond Blood and Bone
Beyond Blue
Beyond Boundless
Beyond Death:Monster
Beyond Earth
Beyond Floating
Beyond Foundation
Beyond Gods
Beyond Humanity
Beyond Humanity: Lightning Falling and Hook of Rage
Beyond life
Beyond Limitations
Beyond Mortality
Beyond The Abyss (Rewrite)
Beyond The Average Isekai (A Litrpg)
Beyond the Balance
Beyond the Black Sea
Beyond the Bridge
Beyond the Dungeon
Beyond The Evergreen
Beyond The Game
Beyond The Game (Abandoned)
Beyond The Grey Skies
Beyond the Horizon
Beyond the Horizon's Eye
Beyond the Mists (Shuli Go Vol. 1)
Beyond the Ordinance
Beyond The Other World
Beyond The Primordial Void
Beyond The Primordial Void (Dropped)
Beyond The Primordials
Beyond The Sky
Beyond the Star Ways
Beyond the Stars
Beyond the Veil
Beyond The Wall (Complete)
Beyond Time and Space
Beyond Truth
Beyond Worlds
Beyond/Odyssey
Beyond?
BF Training Course
Big BOSS of the Game Industry
Big Damn Heroes
Big Leagues
Big Red Button.
Billionaire's Fake Wife
Billionaire's Identity
Billions Of Reasons
Binary Blood
Binary of Life and Death
Binary Progression
Binary Progression: The wild west of MMOs
Binary Soul
Binded
Binded In The Dark
Bio Synthesis
Biomancer: Songs of Sirens
Birds of a Feather
Birds of Prey
Birth Cult
Birth From Darkness
Birth of A Death God
Birth of a Devil
Birth of a God
Birth of a Monster
Birth of God
Birth of Mana
Birth of Sin
Birth of the Conqueror
Birth of the Dragon King
Birth of the Dragons
Birthday Online
Birthright
Birthrights
Bite
Bitten
Bitter
Bittersouls
BKR: Bandit King Reborn
Black And White
Black Apocalypse
Black Beast
Black Belly Enchantress
Black Blood
Black Blood (now on break... it'll be back... Eventually...)
Black Book Saga
Black Butterfly: The return of the legendary blood slaughters
Black Cloak, White Art
Black Coin
Black Core Summoner
Black Death
Black Dragon Rising
Black Dragons Rain
Black Feather
Black flame Devil
Black God of Lightning.
Black Heart
Black Heaven
Black Heaven Ascension
Black Hole Traveler: Beyond Jupiter's Door
Black Home
Black Ice
Black Iron & Cinder
Black Kingdom By CallMeDeliverUs
Black Knight
Black Magic
Black Magic Hero
Black Meridian
Black Mist: Daniek of the Black Blood
Black Moon
Black Rain
Black Rock
Black Roses Rewrite - YYH Fanfiction
Black Sheep
Black Sheep - A Permadeath Book
Black Sheep [dropped]
Black Sheep's Freedom
Black Sky
Black Space
Black Steel Brandy
Black Storm
Black Sun
Black Sun Rising
Black Tears
Black Tears (to be revised)
Black Tiger God (黑虎神)
Black Titan
Black Watch Asylum (Hiatus)
Black Wind
Black Wing
Black World
BlackCrown
Blackened Blood
Blackened Blossoms
Blackfire
Blackfire (OELN)
Blacklight
Blacksmith
Blacksmith of the Apocalypse
Blackthorne
Blackula
Blackwood Company (A novel of grimdark sword and sorcery)
Blade
Blade Judgement
Blade of Chaos
Blade of Crom
Blade of Death
Blade of Gaia
Blade of shattered reality
Blade Origin
Blade Quest Vol.1
Bladed Advent
Blademage Beastmaster
Blades and Bonds
Blades and Mana
Bladevoker's Prerequisites
Blake Byron: Paranormal Investigator
Blame (Hi-Chan)
Blank: a Story of Good Intentions
Blanks: Magi Of The Red Desert
Blankspace
Blarg the Meh Ai
Blasphemous Vein
Blasphemous Vein - Blasphemous Series
Blastocyst
Blaze
Blaze contractor
Blazing Translocation
Bleeding Hearts
Blend
Blenders : tale of the greatest creator
Blessed
Blessed Time
Blessed with a curse (BwC) [Tryout.]
Blessing
Blight and Bloom
Blightbane
Blighted
BlIghted: A Plague Rat's Tale
Blind
Blind man's path
Blind Punch
Blind Spear Goddess
Blink
Blink, A Dungeon Core Story Unlike Any Other (Because it's terrible beyond belief)
Blinker
Blockage of Writing
Blocked
Blood & Carrots
Blood & Fire: Insurrection
Blood & Paint
Blood Amongst the Sand
Blood and Bones
Blood and Gold
Blood and Honor
Blood and Honor (Rewrite)
Blood and Honor: Ascension
Blood and Honor: Dark Scion
Blood and Honor: Deathwalker
Blood and Honor: Emperor's Fangs
Blood and Honor: Engineer's Aptitude
Blood and Honor: Fallout
Blood and Honor: Honor among Thieves
Blood and Honor: Redemption
Blood and Honor: Rise of Atlantis
Blood and Iron
Blood and Magic
Blood and Passion
Blood and Sacrifice
Blood and Silence
Blood and Silver
Blood and Soul
Blood Born
Blood Brothers Rising
Blood Calamity
Blood Control
Blood Creed
Blood Cursed: Demon of Time
Blood Destiny
Blood Drinker
Blood Drive
Blood Emperor
Blood Emperor [Dropped!!]
Blood Feud
Blood Fractal
Blood from Steel
Blood Imperium
Blood in the Wires
Blood is dark
Blood Island
Blood Knight
Blood Mage Bastard (A LitRPG)
Blood Merchant Empire
Blood Moon Hunters
Blood Night (The Scarlet Jane Files, #1)
Blood of an Inhuman Hitman
Blood of an Inhuman Hitman (Rewrite)
Blood of Lilies
Blood of the Guardian
Blood of the Past
Blood of the Priestess
Blood of the Serpent
Blood Prejudice
Blood Princess (completed)
Blood Redemption
Blood Rejects
Blood Rising
Blood Rose
Blood Sapphire
Blood Seekers -- The Monolith
Blood Shark
Blood Soaked Star
Blood system
Blood Thick as Steel
Blood Ties: Lastborn of Akatosh
Blood To-Go
Blood Tribute Gacha in Another World
Blood Virtuoso
Blood Virtuoso: a goblin's story
Blood Virtuoso: a monster evolution story
Blood Virtuoso: an evolution story
Blood World - Sacrifice
Blood Worth
Blood, Drugs, and a Pinch of Magic
Blood-queen Ssyba
Blood-Sakura : The Paranormal Residence
Bloodbath
Bloodborne
Bloodgames - A Battle Royale LitRPG
Bloodlain
Bloodless
Bloodline
Bloodline plunder
Bloodline: World Domination
Bloodlines
Bloodlust
Bloodmoon Destiny
Bloodreign
Bloodshard
Bloodshard: Stolen Magic
Bloodshard: Stolen Magic (COMPLETE)
Bloodshed
BloodSmeared
Bloodsong
Bloody Angel
Bloody Conqueror
Bloody Dragon
Bloody Grass
Bloody Hell
Bloody Killing Game
Bloody little Monster
Bloody New World
Bloody Specialist
Bloody Wave Unlimited
Bloody Wonderland
Bloom
Blooming in the dark
Blooming Thorn in Another World
Blud
Blue Blood
Blue Blood Servant
Blue Boundary
Blue Core
Blue Cruelty
Blue Hills
Blue Mist
Blue Moon Emperor
Blue Moon Saga
Blue Phoenix
Blue Pill
Blue Screen Blues
Blue Seed
Blue Seed - Path of a Mage King
Blue Soul
Blue Star Cultivator
Bluelight Chronicles - Going Solo
Blur
Blurred Border
Blurred Lines and What Crosses Them
Blut und Eisen: Blood and Iron
Boarding School Blues
Bob and Sam up to no Good
Bob in the land of the gods
Bobb builder system
Body and Soul
Body Molder
Body&Shadow
Bogatyr
Bon Week-end
Bonded
Bonded By Blood
Bonded Spirits
Bonds of a Brother: The Iron Cross
Bonds of Gold (HP Fanfiction)
Bone and Cartilage
Bone Dungeon: Book 1 in the Elemental Dungeon Series
Bone Lord
Bone...r?
Boneca
Boneless Beings
Bones
Bones in the Sun
Bonfire of Souls
Boogeyman
Book 1 of the Falconer series: Hearts of Ice
Book 1 of the Immortal Sun Mist Emperor Saga- Novus Magus
Book 1 of the Immortal Sun Mist Emperor Series- Novus Magus
Book 1 | Hibryds
Book 1: A certain magic kingdom
Book 1: Demonic Wolfsbane
BOOK 1: THE CURSE OF ASMODEUS -- (a Perth's Accidental Superheroes series)
Book 1: There is No God
BOOK 2: THE WRATH OF ASMODEUS -- [a Perth's Accidental Superheroes series]
BOOK 3: THE REVENGE OF ASMODEUS -- [a Perth's Accidental Superheroes series]
Book 4: Escape From Planet Of Asmodeus [ A Perth'S Accidental Superheroes Series ]
Book 4: The Brothers Dyne
BOOK 5: THE RETURN OF ASMODEUS -- (a Perth's Accidental Superheroes series)
BOOK 6: THE SON OF ASMODEUS (a Perth's Accidental Superheroes series)
Book Of Chaos
Book of Creations
Book of EscaLod
Book of Fates: The Forgotten Shores of Ferax
Book of Heroes - Rise of the Shadow Walker
Book of Kindness
Book of Liz
Book of Monsters
Book of Mortus
Book of Reality
Book of Sand
Book Of Soul
Book one: Change
Book One: Queen of The Forest
Book Worm
Booked
Bookkeeper
Bookworld Online: Marsh Man
Bookworld Online: The Rogue Necromancer
Bookwyrm
Boop!
Borderlines
Bored Evil
Bored Gamer in Other Worlds
Bored Hero
Boredom Made Me Do It.
Born a Demi-God (Hiatus)
Born a male xenomorph
Born among the Stars
Born as Slime In New World
Born From Evil
Born in Abyss: Dark Devil
Born in Abyss: The Dark Devil
Born In One (one piece fanfiction)
Born of Dusk
Born of Hate: Spawn of Hatred
Born to Heal, Grown to Steal
Born under the moon
Born with a Dragon Tattoo(Dropped)
Borne of Caution
Borneo
Borrowed Time
Borrowing Divinity
Boruto:narutos next generations: the saga of daemon
Boss
Both Ends of the Gun
Bottled up wishes
Bottom Rung (Dungeon Runner, book 1)
Bottomless
Bottomless earth
Bound
Bound by Blood
Bound by Duty
Bound by Fate
Bound by life and death
Bound by Moonlight
Bound in the Dark
Boundless (Completed)
Bounty Cats
Bow down to your King!
Bow of the North
Brain Cultivators
Brainiac Dungeon
Branch Adventurers Guild
Branch Adventurers Guild [Dropped]
Brand New Night
Brand New Stallion
Brand New World
Brand of the Dragon
Branded
Brave Realm Odyssey - Adventurer Resolution
Brave Soul
Brave World Online
Bravest Soul
Breach World Championship 2081
Breaching Reality
BreakDown
Breaker of Chains
Breaking Chains
Breaking Horizons: Book 1: Snared Origins
Breaking Limits: A DBZ Fan-fic
Breaking Point
Breaking Point Awakening
Breaking Syd
Breaking the constellations
Breaking the Mold
Breaking the World with Cut & Paste
Breaking up, No Joke
Breakout: The Evolution of a High School Nerd
Breakout: What Did I Get Myself Into?
Breakout: What Did I Get Myself Into? (Original English Light Novel)
Breakthrough
Breathe in the Embers
Breathing Hurts: Short Stories
Bred to Die: Confessions of a Vat Grown Troll
Brewer King
Brian Saves the World, Maybe
Brian the Drow: A LitRPG Adventure
Brian'S Note Book
Briars and Thorns
Bricks of The Temple
Bride of Prince
Bride of the Dark Lord
Bridge of Storms
Bridging The Gap; The Final Records In Unova: An Autobiography
Bright "yuri"
Bright Battle Story: Tactics Heart
Bright Decay
Bright Feather
Bright Night Online
Brightest Doom
Brightstar: The Rising Superhero
Brimstone
Brimstone Fantasy
Bring me back to change that life!
Bringing Anime Skills to Another World Using Imagination
Bringing Chaos to the Immortal World with God's Powers
Bringing Earthling to Conquer Another World
Brink
Briox the Magus
Broadway Blue
Broderick's Home for Curious Kids
Broken
Broken Angel
Broken Chains
Broken chains of mortality
Broken Cheat
Broken Is Beautiful
Broken Kaleidoscopes
Broken Lance
Broken Pieces
Broken Reality
Broken Realms: Battle of the Gods
Broken Shards
Broken Skulls, a Skeleton's Tale
Broken Sky and Shattered Earth: Apocalypse Convergence
Broken Soul (MoTheGreatOne)
Broken System
Broken Worlds
Broly In Naruto
Broly In Naruto (COMPLETED)
Bronze Mirror
Bronze Sun: The Red Smith (LitRPG + Crafting)
Bronze Wings: A Steampunk Pirate Harem Adventure
Brotherhood of Assassins
Brothers in Arms
Brought my Shotgun to the Seven Seas
Brown-Eyed Heaven
Brujas de la Noche
Brutality
Bruxas da Noite
Bubbles Goes Wild
Bubin
Buddy System
Buffy's New World Order
Bug (title pending)
Bug in This Game
Bugs
Bugs and Blades
Build-A-Harem (ongoing)
Builder of Power
Building a nation and make its citizen happy
Building A village in Naruto Universe
Building a World From the Ground Up
Building Home
Building Home Book 2 - Rescue
Building my faction in another world
Building the Star Forge Empire
Bukowski's Broken Family Band
Bullet Blonde
Bullet In Spell Land
Bullets & Spells
Bumi
Bunkercore
Bunnymancer
BurgerPunk: Pizza Time
Buried with Secrets
Burn Artist
Burn in fel fire
Burned Phoenix Rises
Burning Heavens
Burning Soul
Burning Stars, Falling Skies
Burning Tears
Burning Winter
Burra: Short Stories In the Shaper Universe
Business Manager in a Barn
Business With Pleasure
But I never wanted to be involved
But, Have You Read This Yet?
Butterflies and Pins
Butterfly Weed
Butterfly's Dream
Buzoku Zero
By Any Magical Means Necessary
By The Sword
By Word and Deed
Byōki no hitobito wa betsu no sekai ni tsurete ko raremashita.
C l a i r e
C.O.L.A. Beration
Cadorna Keep
Caesar Augustino [Infinite Dendrogram Fanfic]
Caesar Augustino [Original Character-centric Infinite Dendrogram Fanfic]
Caged Demons: Entrapment
Caged. Unleashed. Extinct.
Cain's Daughter: Baptism of Fire
Cairo
Calamity
Calamity Blade
Calamity Lord Academy: What is a Human Doing Here?!
Calamity Mandate
Calamity Messenger
Calamity Star
CALAMITY — anthology
Calandoris
Calavera
Calforn Chronicles (Original)
Caligo Tenebris
Calixon - Machiavellian/Satirical Romance
Call it a Mission
Call Me Emperor
Call of Carrethen
Call of Tardigrade
Call of the Builder: Sunken Secrets
Call The Manager
Calla
Called Upon
Callie and Bob
Calm Calamity
Cambion
Camelot Defiant
Camelot Dungeon
Camelot Overthrown
Camelot Resurgent
Camiare: An Isekai
Campaign: A Project Starfarer Sidestory
Can a holy hero be born from such a person?
Can a Lich Cry
Can A Random Dude From A Village Defeat An Overpowered Demon Lord
Can I Borrow @You?
Can i please get a female demon lord on the 10th world(Hiatus)
Can I really create a VR game?
Can I really keep my Goddess Wife to myself and away from all the Crazy OP MCs?
Can somebody save me? Really? No one?
Can you Hear the Stars Calling?
Can you please stop killing me? a lit RPG adventure
Can't a Girl be a Fearsome Demon Lord?
Can't Cure Deceit
Canaan: My World To Live
Canary
Candlelit Lives
Candlemaking: A VRMMO Tale
Candor: The Forgotten House
Candor: The Lost House
Caninstinct
Caninstinct (Hiatus until January 2021)
Cannibal Cheerleader
Cannibal Dungeon
Cannon Fodder
Cannon Fodder - A LitRPG Story
Cantaga Station
Canticle for the Death Weaver
Canticle: Code Caligula
Cantina KnowWhere
Cantrip - A Wizard's Tale
Capo: Rise of a Gang Lord
Captive God
Captive Hero
Carabell's Lowlife
Card Game
Card Hero 2020
Card Master System
Cards of the Lake
Cards of the Royal Guard
Carefree Cultivation
Careless Wish
Cariosus
Carl@Fire
Carn Online: Second Chances
Carnage
Carnivores: Aurora
Carrion
Carrion Crow
Cartilage Of Life
Cartoon Vs Rpg World[Working Title]
Carus
Carus - Libertas
Carving a Path
Casa do Diaño: The Fool
Case Notes: L0St
Casimir the Savior
Cassandra
Cassidia
Cassidia Book Two: The Royal Guard
Cassidy's Change
Cast
Cast 2
Cast In Steel - Transferance
Cast Out
Cast Under Ellitis
Castaway of Aturge
Casted Away {will probably change the title}
Castle Kingside
Castlebound
Casus Belli
Cat Girl Was Not My First Choice
Cat Who Walks Thru the Wall
Cata Maestra
Cataclysm
Catalyst
Catalyst: The Trading Card Game
CATastrophe
Catastrophe Teacher
Catastrophic world
Catch All The Girlfriends!
Catch Me If You Can (a PicYourStory entry)
Catch the Wind
Catecholamine Web
Catecholamine Web [ VRMMO litRPG/Xianxia Cultivation ]
Catgirl in the Pantry
Catgirl in the Pantry: Sample Chapters and Bonus Content
Catgirls of GRIM
Catmaster Online: A LitRPG Series
Causality Hopscotch
Cautious Of The Intruder
Cave Crawl
Cave of the Fallen
Caves of B´lo
Caveship
Cayleth
Cecil Bee's Flash Fiction
Cedric Dustbrook and the Woebegone's Revenge
Celeste Academy
Celestia King
Celestial Beings
Celestial Beings: Evolution
Celestial Black Star
Celestial Chance
Celestial Child
Celestial Dream
Celestial Dream – Reincarnated in a cultivation game world
Celestial Forge
Celestial Fox
Celestial Games
Celestial Games (Book 1) Original
Celestial Magus
Celestial of the Void
Celestial Realms
Celestial Reaper
Celestial Spark
Celestial Trinity
Celestial Void
Celestine
Cell
Cennet's Cyborg
Center Stage: Deception
Centifire: Deciphering Magic
Centipede
Centipede: A LitRPG
Central Intelligence Ashitra (Isekai)
CEO Cinderella - A modern humorous retelling
CerberuS Awakening
Cerberus Wakes
Ceron Devourer Of Souls: Book One
Ceusawah
Chain Chronicles of Glory Zero Day
Chain Oracle
Chain Warden
Chain Worlds: In the Name of the Allfather
Chain Worlds: Rise of Three
Chain Worlds: The Third Fleet (Completed)
Chained
Chained Thorn
Chains
Chains of Blood
Chains of Dominion
Chains of life
Chains of logic
Chains of Servitude
Chains Saga -
Challenge: Get Atsuko a Great Life!
Challenged Dungeon and the Arrival of Mana
Challenger of God's Land
Challenging Destiny
Chameleon: My True Face
Champion is Playing
Champion of Chaos
Champion of Death
Champion Of Goddess Of Light
Champion of the Smith
Champion's Path
Champions
Champions and Hunters: Two Worlds Collide
Champions of the Boundary
Chamrosh
Chance for Change
Chance Ignition to Crimson Volition (Six Chances)
Chance Meetings
Chance to a Fantasical World
Chandelier
Change Is Inevitable
Change My Heart, Change My World, Change Me
Change My Mind (Updates Fridays)
Change of Fate
Change The World
Change's
Change: New World
Changed Soul
Changement : Version Face [French]
Changement : Version Pile [French]
Changes
Changing Fate
Changing Monster
Changing Oneself
Changing the course of life
Changing World
Chao Mundi
Chaos
Chaos (old)
Chaos Begets Chaos [Lessons Learned the Hard Way book 1]
Chaos Cannot Be Controlled [Lessons Learned the Hard Way book 1]
Chaos Children: Devourer
Chaos Cloud
Chaos Destiny
Chaos Dragon
Chaos Eyes
Chaos Fiend in the Naruto World
Chaos Fountain | A Chronicles of Ascension Novel
Chaos Godking (Old)
Chaos Godking (ReWrite)
Chaos Of The New Era
CHAOS ONLINE : Paradise of Criminals
Chaos Rising
Chaos Sequence
Chaos Theory
Chaos Traveler
Chaos Traveller
Chaos Vines Online
Chaos Wave
Chaos World
Chaos World Chronicles : Dissolution of Cascany
Chaos Zone online(CZO)
Chaos: Balance within
CHAOS: The Youth and The World of Wonders.
Chaotic Anomaly
Chaotic Awakening
Chaotic Berserker
Chaotic corner
Chaotic Craftsman Worships The Cube
Chaotic Duality
Chaotic Emperor
Chaotic Shadows (Temporary Name)
Chaotic Souls (Dropped...)
Chaotic Symphony
Chaotic|Nonsense
Chapter and Verse
Chapters of Pain [Anthology]
Character Overload
Character Wonders
Charlatan
Charles the Greatest
Charlie Foxtrot Zero
Charlie Foxtrot Zero: Existance Saga Book 1
Charlotte Powers: Diary of a Would-Be Superhero
Charon's Touch
Charred The Final Hope
Chase the Thrill
Chase Your Dreams
Chasing Experience
Chasing Freedom
Chasing Legacy
Chasing Paradise
Chasing Shadows
Cheat Hero
Cheater
Cheater God
Cheaters Always Win
Cheaters Always Win (REVAMPED)
Cheating Monster
Cheating Side Kick
Cheeky little buggers.
Cheese Dungeon
Cherry Outrage
Cheshan
Chessboard War (The God's Game Book One)
Chessboard War: The God's Game Book One[First Draft]
Chevalier of the End
Chicken Is Eat
Chidetan Odyssey
Child God
Child of Bone and Darkness
Child of Dusk, or, I was Reincarnated as an Elven Princess!
Child of Fate
Child of God's Fantasy
Child of God's Fantasy (HITAUS UNTIL FURTHER NOTICE)
Child of Mystery
Child of Night
Child of Nightmares
Child of Terra
Child Of The Moon
Child of White
Children of Aziron
Children of Day Zero
Children of Diaspora : Seeking Shelter
Children of Kathaldi
Children of Nemeah
Children of Nemeah Book 1
Children of Ohst
Children of Sol
Children of the Galaxy
Children of the Halo
Children of the Lodestar
Children of the Plague
Children of the Sands
Children of the Singularity (S4)
Children of the Skies
Children of The Sky: Heartcore
Children of the Sun (Ancient
Childs Life (web cereal)
Chilledren
Chillin' in a dungeon
Chimera
Chimera Aberration - Volume 01
Chimera Commander
Chimera Dire
Chimera King: The Rebels of Last World
Chimera of Reality - Living in a Virtual Mirage - Season One
Chimera of Reality - Season One - Living in a Virtual Mirage
Chimera, The Unwilling Familiar
Chivalrous Thief
Chocolate Obsessed Genius Mage
Choice of Fate: Online
Choice of the Last
Choices
Choose Your Class
Choosing Magic
Chopin's Penny :: (The Reincarnated Diaries of 'The Ant and Grasshopper' through a Classic Composer and a Lazy Witch)
Chopin's Penny :: (The Reincarnated Diaries of A Classical Composer and a Freeloading Lazy Witch)
Chora (The Crystal Saga series book 1)
Chosen
Chosen - A CYOARPG
Chosen by the Laws
Chosen Chaos
Chosen Fate (Reincarnation Giver)
Chosen of Death
Chosen of the Mirth
Chosen of the Veiled God (Rewrite)
Chosen of the Veiled God: Death March
Chosen Shackles
Chosen Sun
Chromatic Caverns
Chromium
Chronicle of the Fated General
Chronicle of the Mad God
Chronicler's Tale
Chronicles of a dark lord
Chronicles of a Dungeon Core
Chronicles of a Dungeon Core (Side Stories)
CHRONICLES of a PC Gamer Stuck Inside an RPG (Book Two: Successor)
CHRONICLES of a PC Gamer Stuck Inside an RPG Book One: Duelist
Chronicles of a Wing Commander
Chronicles of Alex Chase
Chronicles of Anaraxis
Chronicles of Ard : The Silver Demi-Dragon
Chronicles of Arrath
Chronicles of Athionia
Chronicles of Creation - Tale of the Elder Witch
Chronicles of Elulra
Chronicles of Firs
Chronicles of Genticus: Invasion of the North
Chronicles of Grand Deus
Chronicles of Gray
Chronicles of Heroes: The White-Fire Covenant
Chronicles of Hui Yuan
Chronicles of Ionathan Spellweaver
Chronicles of Ionathan Spellweaver [pending rewrite]
Chronicles of Isla - Rise of Ryuk
Chronicles of krendreon
Chronicles of Leofric [Dropped]
Chronicles Of Luvt
Chronicles of Magnus
Chronicles of Mana
Chronicles of Marda
Chronicles of My New Life as a World Owning God
Chronicles of Phartassia: My Teacher, Fox
Chronicles of Rathia
Chronicles of Soma: Rise of a King
Chronicles of Sora: All over again
Chronicles of Sora: Ruler of Rules
Chronicles of The A.I
Chronicles of the apocalypse
Chronicles of the Blade By GnomeBob
Chronicles of The Dragon Empire: Rise of the Dragon King (Rewritten)
Chronicles of the End
Chronicles of the Exalted Sun Child
Chronicles of the Last Hermit
Chronicles of the last Leïn
Chronicles of The Magical Sword Sovereign
Chronicles of the Paranormal
Chronicles of the Radiant God
Chronicles of The Random , Unfinished Stuff I Wrote.
Chronicles of The Shell Mage
Chronicles of the Shura Clan
Chronicles of the Sovereign Otherworlder
Chronicles of the Spider
Chronicles of the StarFighters
Chronicles Of The Storylord: 12th Chronicle - Origin
Chronicles of the Survivor
Chronicles of the Sword Dragon
Chronicles of the Tiger Immortal
Chronicles of the Titanomachy
Chronicles Of The Voidbearer
Chronicles of the Wanderer, Siúlóir
Chronicles of the Weakest Wind Mage
Chronicles of Thyderalis - A Hero Returns
Chronicles of Trial and Error
Chronicles of Trial and Error (re-write)
Chronicles of Two Worlds
Chronicles of Xod
Chronicles of Xod (returning from hiatus)
Chronicles of Zach
Chronicles Of Zaria - Book 1: Dawn Of Akaal
Chrono Born
Chronokinesis
Chronos Ascending
Chrysalis
Chrysanthemum
Chuunibyou in Cultivation World
Ciarra the Cold
Cielo Pantasia
Cinap: Academy
Cinder Roots (Undergoing a Rewrite)
Cinder Roots - A Treant's Tale
Cinder Souls II
Cinderella's Spaceship
Cinnamon Bun
Cionis Key
Cipher's Quest
Ciphered Realm (A LitRPG Adventure)
Ciphered Realm: A LitRPG Adventure
Circle of Shards
Circle Star Adventure. The Ever Blooming Flower.
Circle Star Isekai. A New Beginning.
Circle System
Circumstance
Circumventing Fate
Citadel World: The URANUS code
Citizen Rat and Other Stories
City dungeon
City Dungeon Abyss
City Management
City of Champions Online
City of Devils
City of Ohst
City Of The Banished
City Of The Dead
City of Vengeance
City States (Working title)
Civilization: Rise of Empires
Clademundi: A Post-Apocalyptic DMMORPG
Claimed
Claimed by the Gods
Claiming Worlds
Clan of Exiles
Clan of The Alchemist
Claret
Clash of Gods
Clashing Worlds
Class Crystal Battles
Class Evolution
Class Neutral: Stranger is Coming
Class Z Calamity
Class-A Threat (Disgardium, Book 1) by Dan Sugralinov
Class-Z Calamity
Class549
Class: God-slayer
Class: Master of Time
Class: Space Marine
Classless
Classmancers - A MOBA Esport Story
Classroom of Doom
Clavomancy
Clay the Golem
Clean Goblin
Clean Slate
Cleaning Up The Future
Cleaning Up Your Mess
Clear
Clear Binding
Clear River Flowing Silently
Clearing Waves
Cleric or Necromancy?
Clerical Error: A Challenge of Vircon Adventure
Cliche Necromancer Story
Cliche?
Cliché cliché the classic cancer cliché
Cliché Fantasy I
Climber: Towers of the guardians
Climbing out of the Ruin
Climbing The Aisle of You (MOBALit)
Clock Link: A Story of Magic and Murder
Clockwork
Clockwork Memoria
Clockwork powers? Sure! Wait, why am i on a fantasy world?
Clone-002
Close Your Eyes
Closed Beta [A Star Nova Prequel]
Closer
Cloud 9 Rebirth: Adventure In New Dwarden (Working Title)
Cloud Academy Aerendel
Cloud Dungeon
Cloud Rider
Cloud Shrouding the Sky
Cloudlark
Clouds of Fauna
Clover: A Seeker's Story
Clue
Co:ExisT (The Calm Before the storm)
Coalesce
Coalescence of Two Lifetimes
Coco-chan: The cat that wants to conquer the universe
Coda's adventure
Code Antony
Code Death[Dropped]
Code Jumper - A GameLit Novel
Code name [Blood Cry]
Code Name: Genesis
Code Reader Kagami (LitRPG)
Code Red
Code: Ragnarok
Codename Deathwish
Codename Prometheus
Codename: Eldritch - Screw Sanity . . . I've lost it anyway.
Codename: Freedom - When VR Gaming Hurts
Codename: Raven
Codename: Reaper
Codex
Codex Haereticorum
Codex Nihil
Codex of creatures: Salvation
Codex of creatures: Salvation -Completed-
Codex of Shadows
Codger
Coeus?
Coffee & Slime
Coffee with a side of Villainy
Cogseer
Coiling Dragon: Untold Stories
Coin
Cold
Cold Expanse
Cold Havoc: Carl, the Destroyer
Cold Heart
Cold Reign
Cold Space, a LITRPG space story.
Cold Steel Dig
Cold Sword Mistress
Coldreach (A story about a Prison for Monsters)
Collapse Point Harmony
Collateral
Collection of Gender Swapping Shorts
Collection of ideas
Collection of Short Horror Stories
Collection of Short Stories
Collection of Things [very bad, don't read]
Collective Mind cannot understand
Collector's Guild
Collector's Quest
College Diaries
College Student To Chosen Hero
Collision of Myths
Colonization
Colonize
Colopra Online: The Artificer
Colorblind
Colorful World
Colors
Colosseum 72
Colosseum of Indossus
Colosseum Of Multiverse
Colossus of Catastrophe
Colossus' Dream
Colossus' Legacy
Coma (LitRPG Story)
Combat Archaeologist: Rowan
Combat Origin: A Dystopia Gamelit Adventure
Come And See
Come Sevenfall
Come to Management
Come to the Tree
Comfort Creatures: The Case of the Rogue Creature!
Coming Back Home
Coming Down
Command Line: Failure
Commander Daggen
Commoner Online
Companion Farmer
Company of Heroes: Power Fantasy
Competitive Edge: The Rebirth of an Idiot
Compilation of short stories
Complaints: Working At A Store That Sells Gender-Swapping Products
Completely Lost (Dropped)
Completing the List
Compline
Composer
Conba Shiroppu
Concept of the Novel
Concept Slayers
Conception
Conclave of Tyrants
Concordant Fall
Concrete Chaos
Condition Evolution
Confessions of a 22 year old Introvert
Confessions of a Teenage Celebrity
Confessions of the Magpie Wizard
Conflagration - A Fantasy Haven Series part 1
Conflicted Feelings
Conflictos Arcanos
Conflicts of Eriador stories
Confluence
Congratulation, You got the Job!
Congratulations, You're Dead!
Conjured Villain
Conquer
Conquer Everything
Conquer the World
Conquer Your Own Fate
Conquering The Heaven
Conquering the World as a Goddess
Conqueror
Conqueror Online: Soul Summoner
Conquerors
Conquerors (Dropped)
CONQUEST (DarkForce: A GameLit Saga Book 1)
Conquest Apocalypse
Conquest of Arcadia
Conquest of Avalon
Conquest of the Evolutionizing Extraterrestrial Being
Conquest: A LitRPG Story
CONQUEST: The Dungeon Core Gambit Book One (SAMPLE)
Conscientia
Conscious, Conscientious
Consciousness Error
Conscripted
Consignor
CONSOLE ~Another World Transfer Chronicle Starting From the Conversation with God~
Consor
Consort
Conspiracyland
Constant Sin
Constantine
Constellations
Construct Your Fate
Consume
Consume: The Scourge Wars Book 4
Consuming Earths, Devouring Skies
Contact - Humanity Screams Book 0
Contact First
Containment Pacific
Contender
Continental Chaos
Continue Online - Sample
Continuum
Contract from the Abyss
Contract Summoner
Contract: Restart
Contract; A Bless with a Curse
Contractbound
Contractor of Flames
Contradiction
Control + Alt + Sadit
Control the Universe
Controllers
Convergence Cycle Book One: Ranger of the North
Convergence of Fates
Convergence of Night
Convergence Series
Cooking with Oinos
Cool Heads, Hot Hearts
Copper Claws
Copperscale
Copy, Paste: The Misadventures of Milo Two
Copyright [HIATUS]
Cor Navim
Corbeau
Core
Core .001
Core and Guide
Core Chronicles
Core Evolution
Core Microsystem
Core Of Malice
Core of Metal, Heart of Blight
Core Wars
Core Worlds
CORE: The Volcanic Dungeon
Cores
Corinth
Corner West and Lenchen
Corners of my soul
Cornerstone
Cornucopia of Hope
Coronation Day
Corpse
Correcting My Martial Path
Corridor of Fire
Corrosion
Corrupted
Corrupted Guardian
Corrupted soul
Corrupter of Worlds
Corruption
Corruption of the Aether
Corruption of the Demon Lord
Coruscant Ela
Cosanta
Cosmic Bulldozing Team
Cosmic Creator
Cosmic Dungeons
Cosmic Loot
Cosmic Plague
Cosmic Progenitor
Cosmos
Cosmos Traveller
Cosmos-Slaying Calamity Blade
Counter Magic
Counterattack: Reborn into Warmth
Counterpart
Counterwizard
Countless Dreams
Countless Minds
Coupe - The Art of Rebellion
Couple That Can't Touch
Couplet
Covenant Sinners: The Origin of a Demon Queen
Cowboy, Reborn.
Cowboys and Wizards
Crack in the Vault of Heaven
Cracked
Cracked Coffins {Book One}
Cradle
Craft Code: Part-time Adventuring in the Underworld
Craft Codex
Craft Codex: Leveless Adventure in an Altered World
Craft Codex: Leveless Adventurer in an Altered World
Craft Codex: Part-time Adventurer in an Altered World
Craft Codex: Part-time Adventuring in the Underworld
Craft Spirits
Crafter's Passion (AKA Gleaners' Guild)
Craftsman
Craftsman of Blood: Demonic Beginnings
Craftsman System In My Hero Academia
Craftsman System In My Hero Academia (COMPLETED!)
Crafty devil
Crain Chronicle
Crap
Crash Alive
Crashed Into Fantasy
Crashlanded on an Unforgiving Hellscape
Craven
Craven - LitRPG
Craven: Reincarnated Mercenary[First Draft]
Craving for Potions (RAGEQUIT)
Crawling Towers
Crazy Blacksmith
Crazy Diamonds
Creases and Folds by Origami
Creating A Continent of Magic
Creating a world [Russian]
Creating a World RPG
Creation - The Path of a God
Creation Online: Origins
Creation system
Creative Dumpster Fire
Creative thinking is everything I have
Creative Writing Prompts Writing Practice
Creativity Can Fix Things
Creator
Creator Advance
Creator Goddess Lisa Strife - Book 00: Welcome to Your New Normal
Creator of Worlds
Creed
Creep
Crest Fallen
Crestruction
Crew of the Helianthus
Cries from the Dust (Working title)
Criminal Lord
Crimmortal ; Minusomega
Crimson
Crimson Cross: The Proving Grounds
Crimson Crow: Thief of Fortune
Crimson Crown
Crimson eyes in a world of cultivation.
Crimson Gloom
Crimson Ice
Crimson Love(BL)
Crimson Marble
Crimson Moon
Crimson Night Sect Young Ancestor
Crimson Pervert
Crimson Qi
Crimson Sky
Crimson Snow
Crimson Violet
Crimson: Life in the Virtual World
Crisis
Crisis of Civilisation
Crisis of Evolution
Crisis Zero
Critical Hero
Critical Hero Arc 1: The Union of Two Cursed Swords
Critical Protector
Critically Impaired
Crocodile Reincarnation Story
Croenas story of creation
Cross Gun
Cross Roads: God's Reminder (Book Two)
Cross Roads: The Monsters Among Us (Book One)
Cross Roads: Wolves of Oleander (Book Three)
Cross world crisis
Cross-Worlder
Crossing Over: Chronicles of DxD
Crossing Paths with a Snake
Crossing The Divide
Crossliner's coup d'etat
Crossroad Paradise
Crossroads
Crossroads - Tournament of All
Crow
Crowfeathers
Crowfeathers Part I: An Ill Wind Over the Capital
Crown of Darkness
Crown of Despair
Crown of Heroes
Crown of the martyr and martyr of the Crown.
Crown of Thorns
Crownless: Veni Vidi Vici.
Crows Feast
Crucible - A Lost Dungeons Tale
Crucible of Worlds
Crucis
Cruel Affinity
Cruel reality
Crushed and Cursed
Crushing Hearts
Crushing the Apocalypse
Cry little demon
Cry of the Mer
Cry of the Mer Extras
Cryptic Asunder
Cryptic Asunder (Book one)
Crysolis
Crystal Core
Crystal Creature
Crystal Down
Crystal Evolution! The Tales of a Ruler Crystal!
Crystal Guardian
Crystal Heart
Crystal High
Crystal Magic
Crystal Shards Online - A LitRPG Series
Crystal Skies
Crystal Trouble.
Crystalise: The Exaltation System
Crystals and Failure
Crystillya: Two Worlds
Cuddle & Monster
Cultivating Civilization
Cultivating Dungeon
Cultivating Earth
Cultivating Earth [Hiatus]
Cultivating Elf
Cultivating Godslayer: Another GameLit Harem Novel About a Cultivator Who Reincarnates in a World of Magic
Cultivating Magical Kingdoms ?✨?
Cultivating Monster
Cultivating Queen of the 13th Realm (slow releases due to me being lazy)
Cultivating Slime
Cultivating the Cosmos
Cultivating the Universe (Temporary Hiatus [Until June])
Cultivating with Anime System
Cultivation Anomaly
Cultivation Anomaly Type 1B
Cultivation Anomaly Type 7A Variation 3Z
Cultivation Apocalypse
Cultivation Apocalypse [Rewritten Version]
Cultivation at home!? ( CAH!? )
Cultivation at Home!?00
Cultivation Bug Fuyo
Cultivation Can Wait; Anime Is My Fate!
Cultivation Is Now A Reality
Cultivation of a Phoenix
Cultivation Online
Cultivation Path of the Black Dragon
Cultivation Path of the Black Dragon [No Longer Being Written]
Cultivation Queen
Cultivation Sect in Great Age of Piracy
Cultivation System
Cultivation Systems
Cultivation with a status screen
Cultivator in a Magic World
Cultivator in Narutoverse
Cultivator In The Magus World
Cultivator's Fantasy
Cultivators are extinct!
Cultivators: Journeys (Hiatus)
Cultivine
Curiosity Didn't Killed the Dungeon
Curiosity killed the cat
Curiosity Killed The Imp
Curious Tales: Assorted Fantastical Fiction
Curo [Hiatus]
Currently Being Edited Into Actual English
Curse Eater
Curse from God, Live a Thousand Lives: Second Life
Curse Gunner
Curse of Change (Hiatus)
Curse of Clwyd
Curse of Hades in Another World
Curse of Immortals: Tempestatem
Curse of The Dark Side
Curse of the Drakku: Origins
Curse of the Forsaken
Curse of the Kat
Curse of the Kat (Dropped)
Curse of the Lycan
Curse of the Reaper
Curse's Curse (On-Hold)
Curse: Birth of The Cursed Magician
Cursed Alter (First Draft)
Cursed Anti-Hero Against the Gods
Cursed Armor Reincarnation
Cursed Blood
Cursed by a goddess...
Cursed child
Cursed Child of the Eternal Realm
Cursed Children
Cursed Era
Cursed Forge of Destruction
Cursed Heroine
Cursed Reincarnation
Cursed Trainee
Cursed With Ice
Cursed World (LitRPG Fantasy Adventure)
Curses
Curses, magic, and curiosities.
Curves of the Game
Custom Class
Cute Psychic
Cutest in the Omniverse
Cutthroat
Cy
Cyber Clash Online - Synchronization
Cyber Samurai - A Cyberpunk LitRPG
Cyber V - RoyalRoad Edition
Cyber World Alpha
Cyberblade Plasma
Cybercity
Cyberhawk
Cybernetic Array God
Cybernetic Dragon
Cybernetic Monster Lord
Cyberworld
Cyberworld ALICE: Terror Rising
Cycle of Ruin - Arrival: A LitRPG Series
Cycle of Ruin - Landing: A LitRPG Series
Cycle of the Tides
Cycles of Life
Cycles of Power
Cymurai
CYOA -- Pandora's Gacha World
Cyrus: Return of The Persian Monarch!
Czar Of Combat: Kings
CZEPTA // Light from Darkness
CZEPTA // Light from Darkness - An Esoteric Cultivation Adventure
D&D Adventure Story : Hoard of the Dragon Queen
D+E - Vertigo's Scent
D-Days
D-INJECT Second Birthday
D-Tripper
D.W
Daddy Dearest
Daedalus
Daemon Born
Daemon Dungeon Core
Daemon: A tale of darkness
Daemonia Graveyard
Daeva
Dagger
Daglyr
Dagon, Dungeon evolved
Dah Ork Life!
Dai Kin - Naruto Fanfiction
Daily Journal of a Workaholic
Daily Life of a Bored Archdevil
Daily Life of a Pro Gamer!
Daily life of An Avenger (An Arifureta Fanfic)
Daily Life of Divine Lord
Daily Life of Divine Overlord
Daily Life of NEET Vampire
Daily life of reincarnated goblin
Daily life of reincarnated goblin [Dropped]
Dainatian Chroniclesm *Hiatus*
Dairy of Valerian Laliashili
Dakila
Damian Dawn in another World
Dammit Todd!
Damn it, Maria!
Damn it, Maria! (Published on Amazon and Paperback edition)
Damn! I just want to ask her out!
Damn,Now That'S An Adventure
Damon's Rache
Damsel of Distress
Dan's Shoppe of Oddities
Dance of the Phaegon
Dancer may
Dancing Skulls
Dancing, Falling
Dandelion
Danger Zone
Dangers In My Head
Daniel Haley and the Immortal Ninja
Daniel Solhoeg (A TWI fanfic)
Danimal
Danimal - Español
Danny Styles and the Thunderdome
Dante's Immortality
Dantian: The Unforgettable
Dao Fang
Dao Fang( hiatus)
Dao is All-Encompassing
Dao Mage : Entity of Magic and Dao
Dao of Emperor
Dao of Repetition
Dao of Zenith Chronicles - Visionary Fantasy with Metaphysical Twists.
Dao: Journey to the Top of the Universe
Darcy Sparrow and the Spectral Hound
Dare ga Oujo-Sama?... Boku?
Daredevil : courage and will
Dargon
Darius Supreme
Dark & Light
Dark Academy. LitRPG series: Transformation (Book 4)
Dark Ashes
Dark Avenger: Flames of Hatred
Dark Beginnings
Dark Blessing
Dark blood
Dark Bushido
Dark Chronicles
Dark Design
Dark devourer
Dark Dragon King
Dark Dungeon
DARK EDEN: The Death God's Origin
Dark Elf Maria
Dark Enforcer
Dark Fantasy Short Stories
Dark Flame
Dark historiën
Dark Jokes
Dark Lands: The Exile and the Prince
Dark Light
Dark Lily
Dark Lord Dumbledore
Dark Lord For Dummies?
Dark Lord of Tartarus
Dark Lord Saga (Original)
Dark Mage: The Offer
Dark Memories: Rebirth
Dark Memories: Revival
Dark Metal Minstrel
Dark Mind
Dark Moon : Fallen Heart
Dark Moon : Rise of The Dark King
Dark Night
Dark Pathways
Dark Rain : Book 1 of The Aetherium Saga
Dark Realms Book 1 : Creation
Dark Remnant - Injustice
Dark Retainer
Dark Seas Leading Demise
Dark secrets
Dark Skies
Dark Sky and a New Start
Dark Souls
Dark souls:Greg's Story!
Dark Spine - Envoy of Darkness
Dark Star Survivor
Dark Storm
Dark Thoughts
Dark Veil
Dark Warlock
Dark Weaver: First Apprentice
Dark Wind, Icy Snow - (RyuTar, YinYuan) [BL]
Dark Wizard's Case. LitRPG series
Dark Wolf
DarkBoi69's mediocre, rushed and badly-written aventure
Darkborn
Darkbud's Bloom
Darkened
Darkening winds
Darker
Darkest by Day
Darkest Entity
Darkest Shadow
Darkfall - Armageddon
Darkfall - Armageddon (Dropped)
DARKFALL - Volume 1 - Armageddon
Darkfall -- Genesis -- Volume 1
Darkfall -- Volume 1 -- Armagedden
DarkForce: Conquest Expansion 1 (LitRPG Mini-Series)
Darklands: Book Three of The Rhenwars Saga
DarkLight
Darkness
Darkness Calling
Darkness God Shura
Darkness in the Heavens (Hiatus/Dropped)
Darkness Rising
Darkness within darkness
Darkness, Silence And Really Bad Breath
Darkpawn
Darks Rising
Darkstorm: Book One of The Rhenwars Saga Preview
Darkstory
DarkVoid: The God of Death
Darkwalker
Darkworlds : London
Das Neue Vaterland
Data Dragon Danika
Date of Dawn
Dating a Witch
Dating my fiancée
Dating Trials of a Vampire Queen
Daughter of a Dark God
Daughter of Fire and Water: Awakening
Daughter of Ice
Daughter of the Red Queen
Daughter of Yser
Dauntless Star
David The Gray Mage
Davram Who Sings
Dawn
Dawn Dead (HIATUS)
Dawn Guard
Dawn of Antiquity
Dawn of Darkness
Dawn of darkness(ABANDONED)
Dawn of Discovery
Dawn Of Dragons
Dawn of Gaia Online [Dropped]
Dawn Of Magic
Dawn of Myth
Dawn of Pangea
Dawn of Ragnarok
Dawn of the Abyss: Reincarnation of the Smith
Dawn of the Abyss: Return of the Smith
Dawn of the Apocalypse
Dawn of the Beast Cultivator
Dawn of the Eclipse [Foremerly Known as Soul-Bound]
Dawn of the Gods
Dawn of the megaverse by the great intelligence
Dawn of the Realms: Promised Daughter
Dawn of the System
Dawn Rises
Dawn Weaver - a tale of Dragon Riders
Dawn_Pour
Dawnlands, A New Beginning
Day in the life of a _______ (COMPLETED)
Day of Wrath [Doom 2016/Eternal rewrite]
Day-to-Day Kindred
Daybreak
Daybreak on Hyperion
Daybreak Palace: Legends of the Guiding Threads
DayDream
Daydreaming magic swordsman
Days in Feyhaven
Days of Blood and Roses
Days of Blood and Roses: A Magical Girl Thriller
Dc Warlock
DCO- Dungeon Core Online
De-Monster
Dead Circus
Dead Copy, Isekai ni Shin no Shujinko
Dead Core
Dead Count Fifty
Dead Dragon's Combat Manual
Dead Earth Online
Dead Emotion
Dead End
Dead Fiction Still Here For My Own Cringe Worthy Moments
Dead Gods Tell No Tales (Working Title)
Dead In Peace
Dead in the Water: A Dungeon's Tale
Dead Man Division
Dead mans tale
Dead Men (Duo-OC SI)
Dead Men (Duo-OC SI) (Old Version)
Dead Rising
Dead Soul
Dead Tired
Dead To You
Dead under
Dead Universe.
Dead World Online
Dead World Scavengers
DeadEnd's Isekai
Deadlier of the Species - Book 2 of Descendants of a Dead Earth
Deadliest Sin, Greed
Deadline
Deadly Touch Series
Deadly Warfare - The War Between Great Nations
Deadly Zero HP
Deadman
DeadZone - Synthesis
Deal Breaker
Deal With A Maid and A Bartender
Deal With The Devil
Dealing with a Certain Fox's Antics
Deals & Destiny
Dear Journal
Dear Spellbook
Dearest O'Malley
Death and Dandelion
Death and Deliveries
Death And Disaster And Dungeon World
Death Becomes Him: An Age of Steam and Sorcery Novel
Death before the Beginning
Death before the Beginning (Fantasy/Comedy/Adventure/Action)
Death before the Beginning (Fantasy/Comedy/Adventure/Action/ Unusual LITRPG)
Death Bringer
Death By Crotch
Death by Ex-Girlfriend Vol. 1: Aika Crisis
Death by Ex-Girlfriend Vol. 2: War Cloud
Death by Ex-Girlfriend Vol. 3: Dawn and Dusk
Death by Ex-Girlfriend Vol. 4: Satori Effect
Death by Ex-Girlfriend Vol. 6: The Phantom Pain of Rousoku Himawari
Death by Ex-Girlfriend Vol. 7: Inari Stand-Off
Death by Ex-Girlfriend Volumes 1-7
Death by Ex-Girlfriend: Aika Crisis
Death by Ex-Girlfriend: Dawn and Dusk
Death by Ex-Girlfriend: Satori Effect
Death by Ex-Girlfriend: The Phantom Pain of Rousoku Himawari
Death by Ex-Girlfriend: War Cloud
Death By Protagonist
Death Contract
Death Count
Death Cultivator (Cultivator in Another World Vol. I & II)
Death Cultivator (Cultivator in Another World Vol. I)
Death Cultivator III (Cultivator in Another World Vol III)
Death Drive
Death Embraced
Death Exists Not Under Heaven
Death Fantasy
Death Galaxy
Death God
Death God System
Death God's Adventure in Another World [Dropped]
Death God's Another World Adventure
Death God's Descent (DROPPED)
Death in Siberia (The Last Woman on Earth)
Death Incarnate
Death Incarnate (Completed)
Death Incarnate (Main Story Completed)
Death Is a Reality
Death is Just a New Oppertunity
Death Is Only The Beginning
Death is Pleasant
Death Knight
Death leads to Godhood
Death Lives
Death Loli
Death March to the Rhapsody of a Parallel World ---Fan fiction/Fix
Death Mark
Death Note : A New Story
Death of Humanity
Death Quest
Death Streaming
Death Theory
Death touch
Death Visions
Death with benefits
Death x Rebirth - Apotheosis
Death's Companion
Death's Crown
Death's Dancer
Death's Disciple
Death's Door
Death's Embrace
Death's Gate: A LitRPG
Death's Heir
Death's Lily
Death's March to God- Book 1: Cosmic Beauty
Death's New Entertainment By Zed019
Death's Oracle
Death's Son Desire
Death, Taxes, and the Second Law of Thermodynamics
Death, the Savior
Death-Bound Chronicles: The Unlucky Shadow
Death-Guard Rejects
Death... and me
Death? Not even once!
Deathgod Chronicles
Deathlands
Deathless
Deathless: The Rise of the Unkillable Demon King
Deathlord Eugene
Deathly Dawn
Deathly Sin: Devourer
Deathrow Dungeon
Deaths Door Online
Deaths Usurper *Sorry Done*
Deathstars
Deathsworn
Deathtouched
Deathwalker
Deathwatch Team Fluff: A Warhammer 40k Story
Debacle: A Tale of Tails
Debt Star
Debts Come Due!
Debuff
Dec:Ide
Decapod
Deceiving darkness
Deception
Decide Your Fate Games - R.Malak
Decided not to Kill even if I die
Decimating Gods and Demons
Decimation [ Apocalyptic Novel ]
Decimation Mortism
Deck of Cards
Deck of Souls
DECK: Annoying Dreams
Deckers
Declining Destiny
Decoder;Deconstructor
Decompose!
Deep Ambrosia
Deep Delve
Deep In The Heart
Deep In The Heart (2019)
Deep In The Heart 2019
Deep Sea Shark
Deep Space
Deep Space Combat School: Nexus
DeepDive
Deeper Darker
Deepest Desire
Deepest Dungeon
Deepest Dungeon: Mark and the Lord of Darkness
Defender of Lapu-Lapu City
Defenders of Fantasmyth
Defending Mars
Defiance of the Fall
Defiance: A Hybrid's Tale
Defiant
Defiant [Epic Fantasy]
Defiant Will
Defiant: The Bewitched Demon Hunter
Definitely Not A Super Tale of A Super Hero
Defy the Heavens?
Defy the Legends
Defying Heavens
Defying Souls Gods
Defying World Asura
Deicide
Deities and Mortals
Deity of carnage - Keeper
Deity of carnage - Unholy Kingdom
Deity of the Mist: a Naruto fanfic
Deity's Fragments
Deity: The Beginning
Dekar as Worlds Traveler
Delay of the Demon
Delete
Deleted
Deleted Fiction - Author is Ashamed #3
Deleted Fiction - Author is Ashamed #4
Deletion Cheat(Dropped/Hiatus?)
Deliverance
Deliverance of the Mind
Delsana
Delve
Delvers
Delvers LLC
Dementia
Demesne
Demi-God - A LitRPG
Demigod Battle Royale
Demise of the Gods
Demiurge: The Creator
Democracy in Cultivation World
Demon Affinity
Demon Artificer
Demon Bane
Demon Blade
Demon Blood Chronicles: Emergence (Book 1)
Demon Blood: Book I The Arrival
Demon Bride
Demon Contractor Unknowingly Becomes Less Of A Jerk
Demon Dungeon
Demon Forever
Demon Gf
Demon God
Demon Heart
Demon Hero
Demon Hero Reaper Saviour
Demon Hunt: Revenge of the Orphaned
Demon Hunter Rolland
Demon in the magical world
Demon into modern human society
Demon King 101
Demon King is My Husband
Demon King Or Immortal God
Demon King Reincarnated as the Hero's Child
Demon King's Downfall
Demon King's end (Inactive)
Demon Knight
Demon Legacy
Demon Lord Cthulhu in another world
Demon Lord in Angel's clothing
Demon Lord in Another World
Demon Lord Summoning
Demon Lord teaches his son how to deal with Heroes
Demon Lord try to be Human
Demon lords? Gods? In this Crazy World, I'll fight them all!
Demon of Metal
Demon of the Darkest Night
Demon of the Mind: Cannibal
Demon Of War
Demon Power Ups
Demon Prince Familiar
Demon Queen's Life
Demon Saga - Phoenix Dancer
Demon Slayer: The Kamado Legacy
Demon vs. Angel
Demon's Country Protector
Demon's Journey
Demon's Sinistra
Demon's Sinistra - Arc 1
Demoness in Distress
Demonhunter Zecruix
Demonic Arts
Demonic Cultivator
Demonic Descent
Demonic Dungeon
Demonic Dungeon Uprising
Demonic Fire Cultivation
Demonic Heroine
Demonic Inscriptor
Demonic Intervention
Demonic Souls of Nature
Demonify
Demonization
DemonLord_Floof - The lack of common sense isekai
DemonLord_Floof – A lack of common sense isekai (COMPLETED)
DemonLord_Floof – The lack of common sense continues
Demonlordchens Symphony
Demonology For Morons
Demons and Candy
Demons of Zenora
Dennica/Daystar
Dennis the Conqueror (Sword & Sorority Book 1), A Harem Lit Fantasy Novel
Denouncer of Fantasy
Densetsu: A Beautiful Day
Denying fate : path of the dark paladin
Deployed to Destiny: Elite Force in Another World
Deployed to Destiny: Elite Soldier in Another World
Depravity and Debauchery in the Southern Kingdoms
Depth
Depth's of Enhancement
Derelict
Derelict Beginning.
Dergons
Descend
Descendant of Dawn
Descendant Of Nightmare
Descendants of a Dead Earth
Descendants of Cosmia
Descendants of the Divine
Descendants: Lost Auradonian Queen
Descending to Mortal Realm
Descent
Descent Into Entropy
Descent of the Strongest God
Descent of Wrath
Descent to Union
Descent: Resonant Core
Descent: Resonant Core (Book 1 of the Chaos sworn series)
Desert Conquerer
Desert Odyssey
Desert Wanderer
Deshawn Dale and the Hidden World
Design of Hope
Designation: FIRST
Designation: M4R10N3TT3
Desire
Desire Dystopia
desired ERROR
Desires Of Man
Desolada
Desolate Ruler
Desolate Stars
Desolated World
Desperate Hope
Despite not Being a Hero, Saint, or Even a Demon King, I was Summoned
Despondent Divinity
Despotic Heart
Destination: Tomorrow
Destinatus
Destined for Talent
Destined to Wilt
Destiny
Destiny Dice
Destiny Monogatari: The Hidden Object S1
Destiny Online
Destiny Roads
Destiny's Forge
Destiny's Forge (Rewrite)
Destiny: Infernal
Destiny: Infernal [DISCONTINUED]
Destroy The Heavens!
Destroy your new life, repair it, destroy it again by doing crazy things while screaming YOLO!
Destroying the storyline in Xianxia!
Destruction
Destruction Angel Summoned From Being Dead For 500 Years Finds Love
Detective Karma
Detective Karma - The Corruption WIthin
Deterrence
Deus Ex Alice Madness
Deus ex Aliis Mundi
Deus ex Machina
Deus Terra: The Land of the Gods.
Devastation
Deviant
Deviant Crown
Deviant Crown [Complete]
Deviant's Masquerade
Deviant's Masquerade: A world of Heroes, Villains, Rogues, and Family
Deviant's Masquerade: Huntsman's Quest
Deviant's Masquerade: The Anthology Series
Deviant's Masquerade: The Huntsman's Quest
Deviant's Masquerade: The Huntsman's Quest (A hero's CYOA origin)
Deviant's Masquerade: The Huntsman's Quest (Old Version)
Deviation
Devil
Devil Cultivator in a Ability User World (Hiatus/Slow Release)
Devil Cultivator in an Ability User World
Devil Inside
Devil of Crime Alley
Devil of the Heavens
Devil Park Island
Devil Princess Reincarnation
Devil's Daughter
Devil's Doll Reincarnation
Devil's Lake
Devil's Rise
Devil's System
Devil's World
Devil-Marked
Devildom Annihilation: The Epitome of Evil
Deviled Egg
Devils Knight
Devils Out of Inkwell
Devine Intrusion: The Demonic Repentance
Devious Dungeon [Dropped]
Devotion Of An Immortal
Devour
Devour The Cosmos
Devour The Heavens
Devour the Stars (Blood of the Ruler)
Devour: Shiver Online
Devourer
Devourer (seint)
Devourer of All (Blood of the Ruler)
Devourer of Destiny
Devouring Creation
Devouring the Gods
Devouring The Heavens
Devouring The Universe Begins With Reincarnating As a Snake
Dex is for Swordplay
Dex Warrior (Libertas Online)
Dex's Adventure Through The Elemental Nations (Completed)
Dexs/ Clairs Adventure
Diabolic Gamer
Dial (Ben 10/MCU SI)
Diamonds of the Past
DiamonFTW's collection of OneShots
Diaries of a Fighter
Diaries of Nero the Halloween Cat
Diary Log of a Ghost
Diary of a Dungeon Master
Diary of a Hopeless Romantic
Diary Of A Lost Soldier In Another World
Diary of a Mad Vampire
Diary of a reborn witch
Diary of an Insomniac
Diary of Discord
Diary of Erica Kron
Diary of Other-Worldly King: Revisited (R-18)
Diary of the Night Demoness
Diary of the Shadow Queen
Diasori Dynasty: The World's Last Heroes
Dice
Dice of Infinite Fates
Dice, the cube that changes everything: Roll for Initiative
Did U Get The Code?
Dida: A Living Computer Inside Your Head
Didactic Duplicate
Didalam Dunia Raja Iblis
Died and Went to Manga
Different
Different DxD Revamped
Different Point of View.
Different World Along System One Punch Man
Different World along with One Piece System
Different World Reincarnation God Cheat Harem
Different World with Save and Load: A Horror Story
Different Worlds
Dig a Little Deeper
Digging Being Diggory
Digging Holes
Digimon Empire
Digital Demons
Digital Haven
Digital Immigrant
Digital Magical Scientist
Digital Marine
Digital Me
Digital Me - Angels and Devils
Digital Sorcery (A LITRPG Adventure Series)
Digitized
Dilecto the happy skeleton
Dim(5,5,5)
Dimension Breakers
Dimension Eaters
Dimension Extra
Dimension jumper
Dimension leapers
Dimension Mage
Dimension Space - A Dungeon Core Novel
Dimensional Break
Dimensional Colleseum
Dimensional Demonic Phoenix
Dimensional Dissonance
Dimensional Intersection
Dimensional Mage(?)
Dimensional Paradise
Dimensional Rift
Dimensional Wars
Dimensions
Dimensions intersection
Dimensions of love
Dimensión Desconocida
Dinosaur Reborn
Dio, Rise to the top [working title]
Dip$h!+s in Space
Dipp's Uncertain Adventure
Dire
Direction and Magnitude
Director, Machine, Paradox.
Dirge
Dirge of Apocrypha
Dirge of Apocrypha (Cancelled for rewrite)
Dirk Cooper: Paranormal Real Estate
Dirk, and the Black & Orange Catwomen of Betelgeuse VI
Dirt Magic
Dirt Magic (HIATUS)
Dirty Romance
Dis/Connection
Disappointing and confusing
Discarded Plotline (Discarded Monster)
Discidium
Disciple of a Demon
Disciple of the Dark Arts
Disciple of the Dark Arts (Old Draft)
Disciple of the Evil God
Disciple of the Sword God
Disciple.
Disciples of the Demon king
Disciples of The Strongest
Disconnected
Discontinued
Discontinued-Harems Are Evil!!
Discontinued-Legends of Vale Academy
Discontinued-The Fox With No Tails
Discovering Magic
Dishonor
Disintegrate
Dismissing Darkness
Disordered Dreaming
Displaced Emperor Conquering The First Universal Plain
Displacement
Distance Between Dimensions: Abandoned God
Distance Between Dimensions: Rise of the Summoners
Distant Future
Distant Kingdoms: Magic War
Distant Leaps to Circinus
Distant Leaps to Circinus [Obsolete]
Distopia of Man - A Dungeon heart story
Distorted
Distorted Light :TFALM
Distortion: A NPC VS Reality
Dive
Dive Deep
Dive in the Afterdark
Dive Sasquatch God!
Diver
Diverge Summoning
Divide and Consume
Divine
Divine Arts
Divine Bladesmith
Divine Blood
Divine Change
Divine Construct
Divine Diversions
Divine Dragon
Divine Dragon [Hiatus]
Divine Elementalist
Divine Empress of Chaos
Divine Entertainment
Divine Frontiers
Divine Guardian
Divine Hell
Divine Imperium - Warlord of Takamagahara
Divine Inheritance
Divine Intervention Online
Divine Intervention: Cataclysm
Divine Intrusion: The Demonic Repentance
Divine Laws of Mind, Body, & Soul
Divine Limitless System
Divine Locket
Divine locket of Hearts
Divine Macabre: The Philosopher
Divine Man
Divine Pagoda Sect
Divine Painter
Divine Progress
Divine Reader
Divine Rebirth
Divine Salvation
Divine Shopper
Divine Soul
Divine Souls
Divine Sparks
Divine Thorns (Book of Vines)
Divine Thorns (The Book of Eliphaz)
Divine Time Jewel
Divine Valor Online: Against the Heavens
Divinity
Divinity Reforged
Divinity Skill
Divinity War - The Rise of the Gods
Dixie
DIZION: Realm of Mortals
Djinn
Dk
DK (Dropped)
Do Dungeons Dream of Goblins?
Do I really have no skills?
Do Not Awaken The Undead King
Do You Ever Wonder How? How This Came To Be?
Do you fear Death? (Worm/Pirates of the Caribbean crossover)
Do You Like Skydiving?
Doc
DOC: Northern Light
Doctor in Immortal World
Doctor of Rebirth
Doctor Who: An Alternate Sequel Series
Dodge Tank: A Crystal Shards Online LitRPG Novel
Dog-King of the Heavens
DogZ
DogZ (Complete)
Doing God's Work
Doll
Doll of Death
Doll's Smile
Dolos, god of honesty
Domain
Domain of Man
Domain Of Voids
Domain Warz
Domains and Daggers
DomeNET Online
Dominantion of The Greatest Sovereign
Domination
Domineering Frog King
Domini: An Uprising
Dominion
Dominion Tower
Domino Effect
Dominus Hunt
Don't be Mistaken! I'm not a Reincarnate!
Don't Breathe
Don't Burst My Bubble
Don't Do Hidden Quests
Don't Fear the Reaper
Don't Feed The Dark
Don't Just Eat Everything You Find In Caves!
Don't label me!
Don't Put All Of Your Short Stories In One Basket
Don't read this
Don't read this you'll die.
Don't Rush
Don't Stop Me Now
Don't Touch Me, You'll Die!
Don't Worry, We Have The Best Supporter On Our Team
Dont Know How To Delete So Dropped
Doom Guy Isekai
Doomed Dungeon
Doomed To Be A God
Doomsday 2020
Doomsday Pillars
Door 42
Dopamine
Dormir
Dots
Double Cursed
Double Edge Hero
Double Rewards for Half the Cost
DOUBLE SYSTEM- Path to immortality
Douglas Sherman's Journal
Doulou Dalu (Soul Land): The 8th Monster
Douluo Dalu - Elemental Fire God
Douluo Dalu - Hammer God Douluo
Douluo Dalu - The Legend of the Poison Emerald King
Douluo Dalu Fanfiction: The Journey of Li Tian Tian
Dove Clan
Down the Deep Blue Hole
Down the sewer
Down the sewer (complete)
Downfall of Mevobak
Downfall of the Champions
Downfall of the Nanite-Hero
Downloaded
Dr. Frankenstein's Monster, Lady Lovibond, and the mischievous sea
Draconia
Draconia Offline
Draconian System
Draconic Blood
Draconic Overlord
Draconic System Ascension
Draconic Transcendence: Cinders and Ashes
Dracula: London Calling
Dracula: Patient zero
Draegish's Light
Draegona Chronicles: Crystals of Andromeda
Draegona Chronicles: Dragon Warriors of Andromeda
Dragged Into a Different World?!
Dragged Into An Isekai With My Friend Being The Generic Hero
Dragged to another world, I sought independence
Dragon Amongst Wolves
Dragon and Wolf: Two Brothers
Dragon Arts
Dragon Ascension
Dragon Atlas
Dragon Ball Alter: Rise of Little Green!
Dragon Ball Magic
Dragon Ball System
Dragon Ball X The Ultimate System
Dragon Ball X: The Ultimate System [Re-Mastered]
Dragon Ball, A True Coherent Fan-Fic
Dragon Ball: Saga Of The Strongest Human
Dragon Ball: Terror of the Gods
Dragon Ball: That Time I Got Reincarnated as Nappa
Dragon Ball: The RPG.
Dragon Ball:RR
Dragon Carrier
Dragon Child
Dragon Child of Thunder
Dragon Claw Evolution
Dragon Contract
Dragon Core
Dragon Cross [Old Version]
Dragon Cycle
Dragon Drudge and Flame
Dragon Fairy
Dragon Fantasy
Dragon Fist
Dragon Fragment
Dragon God
Dragon God Resurrection
Dragon Gods Bride ? I think you have the wrong soul ...
Dragon Gods king / King of the Dragon Gods : Soaring through whole world
Dragon Guardian
Dragon Hack
Dragon Harem Bulletblade King - Strongest Story on RoyalRoadLegends!
Dragon Heart
Dragon Heart. Land of Magic. LitRPG Wuxia Saga. Book 6
Dragon Heart. Land of Pain. LitRPG Wuxia Saga. Book 9
Dragon Heart. Land of War. LitRPG Wuxia Saga. Book 10
Dragon Heart. Path to the Unknown. LitRPG Wuxia Saga. Book 11
Dragon Heart. Stone Will. Book I. LitRPG wuxia series
Dragon Heart. The Enemy. LitRPG Wuxia Saga. Book 8
Dragon Hunter Online (DHO)
Dragon in another world
Dragon King *FINISHED*
Dragon king system
Dragon Kingdom
Dragon Knight Prophecy
Dragon Mage
Dragon Mage System
Dragon Marksman
Dragon Marksman[Short Hiatus]
Dragon Master: Monster Taming System
Dragon Mastery: Daybreak
Dragon Of Coelum
Dragon of Lighting and Steel
Dragon of Lightning
Dragon of the Void
Dragon Princess
Dragon Princess Reborn
Dragon Reincarnation.
Dragon Rising
Dragon Rising: The Sixth Apostle
Dragon Road: How I Rise in My New Life
Dragon Scythe Online
Dragon Shifter
Dragon Sign: Gold & Glory
Dragon Skin
Dragon Slaying
Dragon Slicer
Dragon Sovereign
Dragon Spirit
Dragon storm: Beginning.
Dragon Sword God
Dragon Throne
Dragon Town
Dragon Wars
Dragon&Dragons
Dragon's Dagger
Dragon's Heart. Stone Will. Book I. LitRPG wuxia series
Dragon's Regalia
Dragon's Rising
Dragon's Road
Dragon's Roar
Dragon's Soul
Dragon, Knight
Dragon, Silver Dragon
Dragon, Silver Dragon; Revelations
Dragon: Birth of an Ancient
Dragon?
DragonBorn
Dragonborn Saga
Dragonbourne
Dragonfall: Enchantment
Dragonfall: Soulborn
Dragonfather
Dragonheart - Dungeon Ritual
Dragonic By person
Dragonic Evolution
Dragonic Evolution [Old]
Dragonknight Chronicles
Dragons of Dark Rebellion in A World of Essence
Dragons Of The Hidden city
Dragons Waking
Dragons, Seapents and Titans
Dragonscale Online Book One: Gilded Dragon Slayer #6
Dragonscape Online [VRMMORPG]
Dragonslayer: Search For A Golden Dragon (Wings of Fire Fanfiction)
Dragoon Isekai
Drak's Chronicle
Drak's Chronicle (old)
Drake
Drakon the Necrolord
Draugr Cell //Layer 01-- Investiture:
Draugur
Dread Necromancer Of Glyphs
Dreaded Duke
Dreadful ability
Dreadlord Wizard
Dreadnought - A Superhero Novel
Dreadnought: Seeking Freedom
Dreadwolf
Dream and Death are Synonyms
Dream Chaser
Dream Connect(Stopped)
Dream Devourer
Dream Dungeon
Dream Engineer
Dream Game: Fighting for my Desires
Dream life!
Dream of Eternity
Dream of Love, Dream of Hate
Dream of the Abyss (renamed)
Dream of the Annihilation Girl
Dream Online
Dream Theater
Dream to Dream
Dream Tower
Dream Weaver ~ The Cursed & The Blessed (Side Stories)
Dream Weaver ~ The LightBringer
Dream Weaver ~ World Liberation
Dream Weaver~ The Cursed & The Blessed ~( Act.1, Act.2, Act.3 )
Dream Weaver~ The Cursed & The Blessed ~~( Act. 1 )
Dream World Online
Dream World Project
Dream; Catcher
Dreambreaker
Dreamer/Leveler
Dreamers Insanity - Pokemon fanfic
Dreaming
Dreaming Clouds
Dreaming Horizon
Dreaming of adventure, I ran away
Dreamland invasion
Dreams Come True
Dreams from the Mingled Earth
Dreams of a Lost World
Dreams of Dust
Dreams of Sabers and Spirits
Dreams of the Aasimar Cleric
Dreams of the Dying - An Enderal Novel
Dreamscape
Dreamscape (Working Title)
Dreamscape Beta
Dreamwalker
DreamWorld
Drew Nance, Girl Detective Book 01: The Secret of the Old Clock
Drew's Story
Drezo Regalia
Drezo Regalia: Rebirth
Drift
Drifted Apart
Drifter
Drifter Arc 1: Power
Drifting Clouds, Sheltered Storms (DROPPED)
Drip-Fed
Drive Time
Driver Mach 1
Driver: Mach 1
Dromadeir
Dropped
Dropped :(
Dropped into a Xianxia World
Drops
Drugs and Foxtails
Druid
Druidic Cultivation
Druidification
Drunk Dungeon
Drunken Brawler
Drunks & Fanatics
Drusus The Mighty
Druvik
Dryad
Dryad Relife
Dryad the Hero Hunter
Du Fyrn Vanyali
Du Shaonu : Lady of Darkness
Dual Cultivation
Dual Nature - A Harry Potter/Percy Jackson crossover
Dual Nature - A HP/PJ crossover
Dual Rebirth (BL)
Dual Soul
Dual Soul [Discontinued]
Dual Soul Reincarnation
Dual Soul Vol.1
Dual Sword God
Duality
Duality of a Soul
Duck and Wolf
Duel Anthology
Dulled Mind
Dullest Adventure Ever
Dumb Dungeon
Dunes of Alkell
Dungeon
Dungeon - blackjack n' Whooters
Dungeon 42
Dungeon 42- Old
Dungeon Academy
Dungeon Accident
Dungeon Adventure: Let's Party Up!
Dungeon AI
Dungeon Alive
Dungeon and Stars
Dungeon Anfoesol
Dungeon Annihilation: A Dungeon Robotics Alternative
Dungeon Apocalypse
Dungeon Architect
Dungeon Automation
Dungeon Automation (Hiatus)
Dungeon Avenger
Dungeon Boss Player
Dungeon Building For Beginners
Dungeon Chef
Dungeon City Vanskoria
Dungeon Code
Dungeon Conqueror
Dungeon Conqueror [12+] (On Hiatus)
Dungeon core
Dungeon Core Abi
Dungeon Core and Dungeon Guide
Dungeon Core Online: Loremaster (fan fic)
Dungeon Core Story
Dungeon Core/Realm Heart
Dungeon Core: Alex : Hiatuss Infinitetum
Dungeon Corps
Dungeon Corps - Maze of Menos
Dungeon Crawler Carl
Dungeon Crawler Carl Book 2: Carl's Doomsday Scenario
Dungeon Crawler Carl Book 3: The Dungeon Anarchist's Cookbook
Dungeon Crawler Carl Book 4: The Gate of the Feral Gods
Dungeon Crawler Darryl
Dungeon Crawler Katia
Dungeon Creator
Dungeon Cultivator: Fallen Gods
Dungeon Darwinism
Dungeon Delve
Dungeon Denizens
Dungeon Divided
Dungeon Eater
Dungeon Ecology
Dungeon Engineer
Dungeon Games
Dungeon God
Dungeon Guardian
Dungeon Heart
Dungeon Hunter
Dungeon I/O (⚒ Crafting ⚒)
Dungeon in a xianxia
Dungeon Instinct
Dungeon Island
Dungeon Isolation
Dungeon Item Shop
Dungeon Life
Dungeon Life: Redux
Dungeon Madness
Dungeon Mage
Dungeon Magic
Dungeon Maker
Dungeon maker out of the dungeon
Dungeon Maou
Dungeon Master in a New World
Dungeon Master Life In Another World!
Dungeon Mastery
Dungeon Merchant
Dungeon Misfits
Dungeon monster (dropped)
Dungeon Oasis
Dungeon of Apples? (Completed)
Dungeon of Avalon
Dungeon of Beginnings
Dungeon of Destruction
Dungeon of Eternity
Dungeon of Horrors
Dungeon of Horrors: Flesh and Blood
Dungeon of Ideas
Dungeon of Immortals
Dungeon of Lights
Dungeon Of Mass Destruction
Dungeon of Night
Dungeon of Seasons
Dungeon Of Storms
Dungeon of the Dark Wilds
Dungeon of the Dead [hiatus]
Dungeon of the Dead.
Dungeon of the Deep
Dungeon of The Deleterious
Dungeon of the Divine Goddess
Dungeon of the Hearth
Dungeon of the mindless
Dungeon of the Mountain
Dungeon of the Northern Lights
Dungeon of the Old Gods
Dungeon of the Stolen Soul
Dungeon Of the Void
Dungeon of Trees and Thunder
Dungeon of Wrath
Dungeon of Wrath [A LitRPG Level-Up Saga]
Dungeon of Yanabie Oasis
Dungeon Pearl
Dungeon Quest Online
Dungeon Rails
Dungeon Realms
Dungeon Researcher
Dungeon Robotics
Dungeon Runner
Dungeon Sect
Dungeon Seekers
Dungeon Ship (Ash Rising)
Dungeon Siege
Dungeon Sniper
Dungeon Soul
Dungeon Spirit
Dungeon Story
Dungeon System
Dungeon Tale
Dungeon Tales: Lands of the North
Dungeon Tower Babel
Dungeon Trope Story
Dungeon War: The Rise of Unknown Dungeon
Dungeon Wars
Dungeon Without A Name
Dungeon World Creator Online
Dungeon's Ascension
Dungeon's Legacy
Dungeon's Path
Dungeon.exe
Dungeon: (Unknown entry)
Dungeon: Guy and Two Girls.
Dungeon: reaching for her
Dungeon: Rise or Fall
Dungeon: The Demon Dragon Core
Dungeonborn - Double Down
Dungeons & Demons
Dungeons & Monsters
Dungeons and Adventurers.
Dungeons and Demons inc.
Dungeons and Dillholes
Dungeons and Dim Hallways
Dungeons and Sewers
Dungeons of the Abyss and the Unchosen Heroes
Dungeons, Dungeoning, and Duty (On Hiatus, probably going to be dropped)
Dungeons. Why You Might Ask? Because I Can!
Dungeonverse
Dungeonwars
Dunrealm : The Chronicles of the Wanderer
Duology Dark
Duology: Light
Duolou dalu:another story
Duplication Gods
Durandel Online (DO)
Dusk
Dusk God
Dusk of mythology. *Hiatus*
Duskblade
Dust
Dust to Dust
Dust: A Romantic Apocalyptic LitRPG Novel
Dust: Before and After Book 1
Dusty the Demon (On Hold, possibly indefinitely)
Dvati
Dwarf Smith From Earth
Dwarf Smith From Earth (The Dwarf, The Mine, and The RPG Apocalypse)
Dwarf Smith From Earth (The Dwarf, The Mine, and the System Apocalypse)
Dwarven Steel
Dwarves of Appalachia
Dwarves of Darkshore
Dwelling Souls - Story Of A Forgotten Wanderer
Dying Dungeons: Dead Kings & Mad Queens.
Dying Shards
Dying was harder than medical school until someone pushed me down the stairs.
Dynasty's Ghost
Dysphoria
Dysphoria - A Dark Fantasy
Dystopia
Dystopia Against Fantasy
Dystopian Dictator
Dystopius
E
E = Magic Squared
Each Determined Child
Eadenara Online
Earth 2.0
Earth 402
Earth AA
Earth Moving Out
Earth Ravaged: The Alliance Chronicles Book 1
Earth Sage Doesn'T Want To Be Bothered
Earth Tactics Advance
Earth to Rae
Earth Warriors
Earth XIV
Earth's Administrator
Earth's Advocates
Earth's Advocates (aka "The Isekai Police")
Earth's Advocates (aka Isekai Police)
Earth's Alpha Prime
Earth's Core
Earth's First Dungeon
Earth's Golden Age: The 100 Day Quest, Book 1 - A LitRpg series
Earth's Greatest Magus
Earth's Hydra
Earth's Second Evolution
Earth'S Strongest Sorcerer
Earth's Uprising
Earth: The Gods' Playground
Earthen Journey
Earthen Lord
Earthly Treasures Pavilion
Earthly Treasures Pavilion [Discontinued]
Earths Eulogy
Earth´s awakening
Eat
Eat and Grow Strong (Old)
Eat. Pray. Evolve!
Eaten By A Slime?!
Eater
Eater of Spirits
Eating Fast Is My "Overpowered" Ability
Eating Fast Is My Overpowered Ability
Eating Gods, Becoming Beasts
Eau de Toilette
Ebon Bolt
Ebony Chitin
Eburnean Passage
Eccentric Soul - Rebirth Into a Fantasy World.
Ecclesia's Table
Echo
Echo Black
Echo Of an Empty Soul
Echo of Earth
Echo of the Hammer
Echo Valley (Updates Wednesdays)
Echoes
Echoes (hiatus)
Echoes Of Memory
Echoes of Ruin
Echoes of Rundan
Echoes of the Lost
Echoes of the Mirror
Echoes of the Past Long Gone
Eclipse Online
Eclipse Online: [Spoon] the Dimension Thief
Eclipse: Rise of a Demon King
Eclipse: The Undying Legion
Economicalopoly
Eczius
Edea Chronicles: Hero Summoning Conspiracy
Edean World Online
Edelinferno
Eden Garter, Dragon Anomaly
Eden no Sekai
Eden Virus
Eden: Memories of a Realm
Edenawe by Rulpra
Edge of Apocalypse
Edge of Chaos
Edge of Eons
Edge of Magic
Edge of Reality (Phantom Server: Book #1) by Andrei Livadny
Edict
Educating E.T.
Eein Saga
Efatra
Eh! Where Did My Pen... Pen... Go!?!
Eh? I am Supposed to be Dead But Now I Get a Deadline !?
Eidolon : Martial Familiar
Eidolon Rebirth
Eigengrau
Eight
Eight God Engine
Eight steps to the end
Eight-Bit Bastards
Eightfold Invasion
Eighty Year Old Cultivator
Eijia
Ein Gard
Einder Bloodline
Einherjar
Eir - The Immortal
Eirineftís
Ekalius Online
El Aventurero Maldito
El Dorado
El Presidente is a dungeon core!
El Sexorcisto!
Elania, Arachne in a different world
Elbard's Uproar(Dropped)
Elder Cultivator
Elder Lich Saga
Elder Scrolls: Naruto
Elder Scrolls: The Master
Elder's Game
Eldergrove
Elderia - Dawn of Creation
Eldest Son of the Heavenly Emperor
Eldingar - The Lady of Golden Steel
Eldritch
Eldritch Cultist
Eldritch Cultist In Another World
Eldritch Entity On A Journey Of Self-Discovery
Eldritch Fantasy
Eldritch Maiden
Eldritch Night
Eldritch overlord
Eldritch Rebirth
Eldritch Rebirth (Original)
Eldritch Rebirth (Rewrite)
Eldritch Sorrow
Eldritch, Fragments from the Abyss
Electric Eastwood
Electronic Pulse
Electrosilver
ELECTUS - A tale of Peaceful Demons.
Eleeah
Element
Element Zero
Elemental Artists
Elemental Chrysanthemum Homeland Online
Elemental Duelist
Elemental God
Elemental Knights
Elemental Monster Tamer
Elemental Nations: Oni from the Leaf
Elemental Ninjas
Elemental Online
Elemental School of Hard Knocks
Elemental Soul
Elemental Sword
Elemental Swords
Elemental Trinity: A Harry Potter/Pokémon Fusion
Elemental Uprising
Elemental User in the world of one piece.
Elemental Warrior
Elemental World Chaos
EleMenTaLenT : A Dungeon Keeper's Tale
Elementalists
Elementals
Elementals: Crystal Garden
Elementarem Vim
Elementia Online: Way of Aer
Elementium
Elements of Reality
Elements of War- Fireborn: The Flames of War
Elements Rising
Elena from Hell (Volume I)
Eleven's Conundrum
Elf anew
Elf War Online
Elfaeria
Elgnis
Eli
Eli's Dream
Eliminator
Eliona's Gate: Hesitant Healer
Eliot Ness for Mayor
Elite
Elitian XVI
Elizabeth the Dark Mage
Elizabeth, Elizabeth
Elm's Horizon
Elrich Saga Yellow Springs Book One
Elrich Saga Yellow Springs Book Two
Elsa's Journey To The East
Elsewhere
Elskria Online
Elswynd
Elten wars
Elten wars (Hiatus)
Elulra the Elf
Elurias
Elutheria: Adventures of a Recluse
Elven Garden
Elves
Elycian
Elysium
Elysium Online
Elysium: Diamond In The Rough
Emancipation - An Isekai Story
Embargo
Ember
Ember in the Ashes
Embers
Embers of Nations
Emblem Above
Embrace of the Ancients
Embrace the Blade
Embrace the Blade [Drafts 1&2]
Embrace the Blade [Dropped/Old]
Embrace the Ether
Embracing Death
Embracing Tears
Embracing the world with happiness!
Emerald Forest
Emerald Skies of Ciel Raven
Emeralds
Emerilia
Emily Doesn't Die
Emily's Diary
Emmy And Me
Emotionless Pain
Empathic capacity of a teaspoon
Emperor
Emperor (皇帝)
Emperor Magus
Emperor NPC
Emperor of All
Emperor of Blue Flower Mountain
Emperor of Death
Emperor of Heaven
Emperor Of Myraid Planes
Emperor of Poker
Emperor of Soul Pets
Emperor Of Space and Time
Emperor of the Cultivation World
Emperor of the Demon race
Emperor Of The End of Times
Emperor of the Era
Emperor of the North
Emperor of Yin and Yang
Emperor Saga
Emperor Saga : Slaves Covenant
Emperor Who Rules Over The Swords
Emperor's Ascent
Emperor's Journey
Emperor's Reign
Emperor's System
Empire at War
Empire Building System
Empire Haven Online
Empire in Crisis
Empire of blood and steel
Empire of Death Saga: How A Sword changed my Life
Empire of Glass - The Heroic Legend of Heron
Empire of Salt
Empire of Souls
Emporium of Awesome
Empress is now LIVE
Empress of Blue Flower Mountain
Empress of the Lost Realm
Empress of the Pillars
Empress Reborn
Empress' Evolution
Empress's Emprise
Emptiness - The Saga of the Void Hero
Empty as tomorrow
Empty Promises
Empty Promises [Cancelled]
Empty Promises [Hiatus]
Empyrean
Empyrean Ascent
Empyrean Blade Kira
Empyrean Ice Emperor
Emulation of chronology
Enable Evolution
Enchant Gunner: Bullets and Magic
Enchanted: Past, Present and Future
Enchanter
Enchanter of the Void
Enchanting
Enchanting Pays Way Better!
Enchantress: Pathways Through Darkness
Enciclopédia Monstro : Monster musume
Encounters Out There
Encroaching Darkness
End
End Boss
End Boss: Shepherd
End of Civilization, First Emperor.
End of Days Microfiction Collection
End of My Boring Life
End of Tales: Gaia
End of the Five, Twenty-three, and Twenty-nine Years Story - Wizards of the Otherworldly Court
End of the World
End World
End's End
Endborn Creation
Endbringer
Endeavor of the Silent
Endeavour
Ender's Adventure!
Ender's Happenings
EndGame Online
Endless
Endless cage(Dropped)
Endless Dungeon
Endless Expanse Online
Endless Fantasy
Endless Fight
Endless Journey: Infinite Realms
Endless Lands
Endless Madness: Gods and Ghouls
ENDLESS MYTH : Surpassing the Gods
Endless Online: Oblivion's Blade (LitRPG)
Endless Online: Oblivion's Promise (LitRPG)
Endless Path
Endless Path : Infinite Cosmos
Endless Possibilities
Endless Prosperity
Endless Samsara, Limitless Nihility
Endless Sky®: Truthsayer (a sci-fi LitRPG)
Endless Stars
Endless Universe
Endless Unknown
Endless Waltz
Endless War
Endless Worlds
Endlessly Salem
Enemy of The Gods
Energon
Energy
Energy Animals
Enganar
Enganar - The Watcher's Tale
Engine: Online
Engineer Army
Engraver
Enhanced
Enhanced!
Enigma - Reborn as a Monster into a World of Heroes
Enigma's Multiverse
Enigma's Multiverse (Rewrite)
Enigma's Multiverse (Rewritten, link in description)
Enigma's Multiverse: Rewrite
Enjoying My Second Life in a Fantasy World
Enlightened Empire
Enlightenment
Enlil, the Immortal
Enliven
Enor
EnRich
Enru: Accursed Child
Ensis Core
Enslaved by the System
Ent of Pyromancy
Entangled
Entangled Fates Book 1 - Quantum Beginnings
Entangled Superposition
Enter Darkness
Enter Elysium
Enter the Storm
Enter the System
Enter The Warlock
Enter: Annwyn Online
Enterria
Entertainment Cafe
Entferner
Enthralled: Book 1 - The Crystal Heart
Entity
Entity(dropped)
Entries and Logs.
Entropy
Entropy (Formerly: Who exactly Am I?)
Entropy Summon
Entropy Summon (LITRPG)
Entropy's Servant
Envy
Enyatta; Daughter of the Library
Eon V
Eoum: The Tenth Summon
Ephemeral Cycle
Ephemeral Reign
Ephemeral Shards
Ephemeral World
Ephemeral: A Journey of Souls
Epic of Caterpillar
Epic of Esloria
Epilogue
Epiphany of the Weak
Epiphany Online
Episode 01: Enter Annwyn Online
Epitaph of Everything
Epoch
Epoch of A.K.
Epoch of Humanity
Epoch: A Berserker's Rise
Epoch: An NPC's Tale
Equilibrium
Equilibrium (Crypto)
ER Vol. 1: Emergency Rabbit
Era of Creation
Era of Genocide
Era of Mutants
Era Of The Kobold
Era: Dawn of the New Gods
Erased
Erased Existence
Eraw : The secret raven
Ercse0
Ered Kilmah, Overlord
Ereidien
Eretriah online. A LitRPG book.
Ergon V
Ericverse
Erika's musings
Eringer
Ero Dungeon Evolution
Ero Dungeon Evolution (RR Edition)
Eros Libera
Erroneous Quest
Error
Error's Game
Erthen Chains
Erwin Siegmar
Escape
Escape - A novella set in the universe of The Net
Escape from Idiocia
Escape from the Dungeon
Escape From ZAN YIDEA
Escape The KNIGHT
Escape the Room Game #1 - The Bedroom
Escaping Ettanward
Escaping the Box
Escaping the System: Avoid Death at all Costs
Escaping Their Grasps
Escapist
Eshra
Eskion -god of all
Esoteria: The Planes of Man
Esoteric Skeleton Dungeon Master
ESP Escapades
Esper
Esper In Magical World
Esper Online: The 15 Thrones
Esper: Search for Power
Espers
ESPU:Zero
Essence of Ash
Essence of the Dragon
Essence of the unRaveled
Essence Weaver
Essense Weaver: Monster Mage
Essentia Animus
ESTUD - Exploration, Study, Trials, Upheaval and Discovery
Esyr, the First Fae Dragon
Et Non Lucem
Eterna's Source
Eternal
Eternal : Bloodborn
Eternal Awakening [LitRPG] [EtA Book 1]
Eternal Battlegrounds
Eternal Beloved
Eternal Bones
Eternal Champion Book 1: Divine Diversions.
Eternal Chronicles: Vampire
Eternal Conflict
Eternal Demon
Eternal Divinity
Eternal Dream
Eternal Fantasy
Eternal Freedom
Eternal Harvest
Eternal Horizon
Eternal Ice Mistress
Eternal Kingdom : A Gift From A Loving Brother in A VRMMO World
Eternal lord
Eternal Luck
Eternal Lullaby
Eternal Magneta
Eternal Mana
Eternal Pact *DROPPED*
Eternal Payment - Angelic Guns and Magic
Eternal Peace And Chaos
Eternal Pheonix
Eternal Plunderer
Eternal Regalia
Eternal Saga : Book One - The Beginning
Eternal Soul
Eternal Succession
Eternal Teacher
Eternal Wind
Eternal Worlds : Auto System
Eternia Memories: 1
Eternia Memories: 2+X
Eternia Rising : Lost
Eternity
Eternity Online, a military sci-fi GameLit Fiction
Eternity Wars
Eternity Wars 1.0 (Dead Version)
Eternity Wars V1 (Dead Version)
Eternity Wars V2
Eternity's Prophet
Eternity's Wake
Ethan's Shield
Ether Flows
Ether mage
Ethereal Bodies
Ethereal Creator of Realms
Ethereal Heavens: Genesis
Ethereal Reality
Ethereal Sovereign
Ethereal Space
Ethereal's 13 Worlds
Ethically Sound Unethical Procedure
Ethos - a KTS novel
Ethria: The Pioneer, An Epic LitRPG Adventure PROMO
Etryria [discontinued]
Ett Tu Tre
EU: Novum Orbis Terrarum
Eulalia's Adventure
Euphoria
Euphoria [DISCONTINUED]
Eusocial
Euterpe Online
Evangeline
Eve of Gods
Eve to Eternal
Even a Hero Needs a Vacation Every Now and Then
Even if the World is Against Me
Even in the afterlife, I still hate mondays ...
Even the heavens will shudder
Evenfall
Evening Shadows
Event Horizon
Event Horizon (S5)
Ever After
Evera: Mourner's Isle
Evera: Mourner's Isle [HIATUS]
Everdell: A Critters Tale
EVERFIRE Online
EverLast(Stopped)
Everlast: Righteous (Names are Earned, book 1)
Everlasting Soul
Everlasting Struggle
Everlasting Throne of Supremacy
Everlasting World Creator
EverSense...Offline?
Everworld
Every Grain of Sand - The Shivered Sky Part 1 - A tale of the war between the angels and demons
Every Hero's Thorn
Every Hero's Thorn (Hiatus)
Every Planet We Reach Is Dead
Every Time I Sleep, I Die
Everybody here is a cultivation idiot.
Everybody Loves Large Chests
Everyday Dimensional Amnesia
Everyday Dungeon Master
Everyday Life As A Prison Guard
Everyday Life As the Demon Prince
Everyday Life with Raptors
Everyday lives of parallel-world cops!!
Everyday normal violence
Everyone Else is a Fantasy Character
Everyone is a Superhero! Apart from me
Everyone is my friend
Everyone Loves Fluffy Tails
Everyone Loves Min-maxing
Everyone thinks I'm an NPC
Everyone's Lv Zero
Everything Comes Down to Klaus
Everything is Worth Killing: Isaac's Tale
Everything Needed to Build a Fantasy World in Countless Easy Steps
Everything will be my way!
Everything's Price
Evil devouring slime
Evil Dragon on Paper
Evil Eye
Evil Eye: Hexcaller
Evil Genius: Ascendance
Evil God
Evil God Mafia
Evil God Slayer - Vampire Lord
Evil Goddess System
Evil Incarnate
Evil Overlord: So Much Dominating
Evil Overlord: The Makening
Evil Overlord?
Evil Star (Grave of Heroes Book 1)
Evil Tree
EvilLive
Evo-Gaming
Evo:lution online
Evocatus
Evolution (Rewrite)
Evolution Arts
Evolution Barricade
Evolution God
Evolution of a Ball of Light
Evolution of a Cultivation Beast
Evolution of a dungeon lord
Evolution of the Lazy Gamer by Bruticus
Evolution of the Living
Evolution of the Skeleton who walked alone in a Dungeon
Evolution of The Skeleton Who Walked Alone In A Dungeon{Revamped Version}
Evolution of the Twin Xenomorphs
Evolution System
Evolution System+Customisation System=Stronger System? Maybe not though...
Evolution's Choice
Evolution- From the Bottom to the Top
Evolution-From the Bottom to the Top
Evolution-revolution ! ( On Hiatus.... I will never give up... just need time. )
Evolution. Starting point: Worm
Evolutionary Prison
Evolutionary Slime (Dropped)
Evolutionist
Evolve
Evolve and Adapt
Evolve or DIE !!
Evolve, Adapt, and Kill.
Evolve: The Scourge Wars Book 1
Evolved
Evolved: The Apocalypse of White Light
Evolving Unyielding Infestation
Ewan story
Ex Machina (Hiatus)
Ex-Angel
Ex-Crown Prince favors the Villainess
Ex-mob boss in another world
EX: Emblem
Exalted Immortal Emperor
Exalted Toxin Lord
Exalted Warlock
Exceed System
Exceed System: The Gambler
Exceptional Normalcy (A Pokemon Fanfiction)
Excitement Turned Real
Excursion
Excursion Book 1, The Goblin Curse. First arc.
Execute Order D20
Executioner
Exeria
Exhuman
Exile Online
Exile: A March On Eris
Exiled Kingdom
Exiled Nomads of the Galaxy
Exiled to a desolate world
Exiles
Existance Saga: Charlie Foxtrot Zero
Existara
Existence
Existence of The Irregular 2 - Reincarnation
Existence Saga: Charlie Foxtrot Zero
Exitium (dropped)
Exodus: The Assassin's Path
Exodus™ Online by B4DDI3Z
Exoglot [0] //Broken Worlds
Exoglot [0] The Sinner Sky
Exorcism 101: Where Love can Cure Ghost Possession
Exosolar
Exousia
Expanse
Experia Online
Experiment
Experimental Dungeon Novel
Experimental human in the new world
Experimental Omnipotence
Experimental Princess
Experimental Wuxia Novel
Exploit
Explore, Search, Hunt
Exploring the Gateway
Exponential Mana Regeneration
Expressionless?
Exrenity
Exsanguinate
Extant Expanse
Exterminator Dungeon
Exterminus - Restart
Extinction
Extra character at irregular magic highschool
Extra Life Online
Extrasensory Perception System (EsPers)
Extreme Heights: Face Your Fear
Extreme Sports!!
Exubera
Exuberance
Exuperius
Eye from the sky: The Journey of Thaim
Eye of Adventure
Eye Of The Eclipse
Eyes Full of Sins
Eyes Of Crimson (Danmachi Fanfic)
Eyes of Eunos - a Kammi Kettu story
Eyes of passion
Eyes of the Asura: A Superhero GameLit
Eyes of the Asura: A Superhero's Tale
Eyes of Time: New World
Ezekiel, an Angel in the multiverse.
Eztiren
F Rank Dungeon King
F**k Me! Hate Me!
F-Ranked Cultivators in an F-Ranked School
F.U.B.A.R.
F:Ran
Fable
Fables: The Forgotten Legends
Facade
Face your Fate
Faceless Phantom
Faceless: The Monster Within
Facet Fatalis
Facilities and monstrosities
Facticity
Faction: Killing Horizon
Factions at War
Faded Grey
Faded Hours
Faded World: The Island
Faeos Book One: The Stuff of Legends
Faerwald - Rise Above
Faery Knight - A Mirai Suenaga Adventure
Fafner the greedy dragon
Failed Creation
Failed Dungeon Inn
Failed Hero
Failed Suicide
Failed World
Fair Princess
Fairy Godmother Inc. (Apollo's Angel- Book 1)
Fairy Hunt
Fairy Knights
Fairy Tail highschool
Fairy tail Star Dragon
Fairy Tail: Fubuki
Fairy Xia Yu Manual Pampering the Beautiful Harem
Fairy-Elf Enigma
Fairytale of Mine
Fais Toi Plaisir
Faith | Blurry Lines
Falcon Punch
Falene Fantasy: The Undying
Falgreys
Falknir - Rising From Ashes
Fall For Me
Fall From Grace - The Prequel
Fall From Grace.
Fall of Jupiter
Fall of Man
Fall of the Seven Kings
Fallacy of Fate
Fallen
Fallen Apostle
Fallen Ash
Fallen Celestial ~ Traveler Of Worlds
Fallen Crow
Fallen Divine Online
Fallen Earl ~ Hidden Boss Capture Target
Fallen Eleven
Fallen From Grace - Blood Beginnings - Book 1
Fallen from Heaven
Fallen from the Moon
Fallen God decides to live a little
Fallen Immortal
Fallen Kingdom
Fallen Online: Dive into Abyss
Fallen Star
Fallen star - A Dragon's tale
Fallen Stars
Fallen Throne
Fallen World (The Dark Enemy)
Fallen Worlds
Fallen Worlds: King's Rule
Falling
Falling from Earth
Falling From Grace, With Style
Falling in Love : I love you, Today and Forever
Falling in love with a witch
Falling in Love with The First King
Falling in Love with The First King - Draft
Falling into Crazy!
Falling Petals
Falling rain
Falling Star of Evolution
Falling Stars
Falling Upwards
Fallout: The Gamer
Fallout: Vault X
Fallsinkplummet;
Falnen
False Dendrite -heaven shouter-
False Fate
False Government
False Poems
False Prophecy
False Prophecy (Prelude)
Familia: Ang simula
Familiar
Familiar In Chains
Familiar Things
Familiar's Chronicles
Family (Omniscient Reader's Viewpoint Fanfiction)
Family business
Family Matters
Family of abnormalities
Family of Fiends
Fanfic Ideas
Fang the Iron Chef
Fangs
Fantasia
Fantasia Online [VR Game]
Fantasia Saga - Book 1: Rise of monsters
Fantasia-The story of the Willful Wolf
Fantasia: Red Dawn (Old Version)
Fantasia: Red Dawn (Rewrite)
Fantasia: The odyssey of magic
Fantasial Apocalypse
Fantasial Rise
fantasial rise [HIATUS]
Fantastic Advancement
Fantastic Darkness
Fantastic Journeys Through the Stars
Fantastika Ultimata: Royal Soul
Fantasy and Terror Klepto's Harbinger
Fantasy Annihilation
Fantasy Collision
Fantasy Craft Online: Donny Opens a Strip Club in Another World
Fantasy fugitives (Hiatus)
Fantasy Hitman
Fantasy In A Turtle's Shell.
Fantasy Inbound
Fantasy into Fallout
Fantasy Mecha Online
Fantasy Mecha Online (Cancelled)
Fantasy Online: Hyperborea
Fantasy Road Trip
Fantasy Royale
Fantasy Tech Online
Fantasy Unlimited (Dropped)
Fantasy Vs Technology
Fantasy war
Fantasy wishes
Fantasy World Adventures
Fantasy world Domination
Fantasy World Epsilon 30-10
Far Behind
Far Strider
Faraway land
Farblade
Farewell
Farm Life
Farmer Boy
Farmer From Hell
Farmer of all Trades
Farmer's Dungeon
Farming For Gold
Faroutposts
Farseer
Fast Food in Another World
Fat Boy Hero
Fatal Chapters: A Guide to Piloting Gods
Fatal Cries
Fatal System
Fate
FATE (chosen by you)
Fate - Led journey in Mythical World
Fate and Chance
Fate Cannot Bind Me
Fate CON-trol
Fate Destroyer
Fate Epsilon
Fate Love Game
Fate of a villain
Fate of Maggot
Fate of Souls
Fate Of The Swordsmen
Fate Online
Fate Online (The Demonborn)
Fate Overcharge (Stalled)
Fate weaver's convergence
Fate's Assassin *dropped*
Fate's Choice (ABANDONED)
Fate's Fortune
Fate's Slave
Fate/Negative
Fate/Regalia
Fate/Resurrection
Fate/Reverse
Fate/Survivor
Fate: A Short Story
Fateburn: Chaos uploaded(ABANDONED)
Fated
Fated Realms: A Tale of Two Siblings (Working Title)
Fated Sword
Fates Parallel
Fath dungon
Father at 15
Father of Monsters
Fathers Bury Sons
Faulted Perfection
Fayde of the Void (OLD VERSION)
Fayde of the Void: The Immortal King
Fayte
Fear and Forgiveness(A Collection of Dark Tales)
Fear and Forgiveness(A Complete Collection of Strange Tales)
Fear Rune - The Abandoned Realms
Fear system
Fear the Netherlands
Fear the wrath of the spider
Fear-Driven (Give and Take Part 1)
Fear: Ever-Changing and Evolving
Fearless
Feathery Delight
Fedora/Katana
Feed The Hunger
Fei Cai's Ascension— Reverend Insanity
Fei's prophecy
Feirut's One-shots
Felice Hybrid
Felicia's Second Life
Felicitas
Fell Deeds
Fell down into a dungeon
Female Immortal's Return to Earth
Female mage, a Baker, and a kingdom
Female Martial Empress
Femalekind
Femalekind Book One (Complete)
Femalekind Book Two
Femme Fatale - An Element On the Run
Fenrin's Tale - a third chronicle of the Children of the Bear
Fenrir Rising
Feral - Evil is a matter of perspective
Feral Shadows
Feral: The Story of a Half Orc
FeralHeart
Fermi Paradox
Feudal Feud
Fever Vine
FFO - Free Frontier Online (on hiatus)
Fiction
Fiddler in Another World
Fidget Spinner Cultivator
Field of blood
Field of Machines
Fields of Deceit (Multiverse OC/SI)
Fields To Fights
Fiends
Fifth Dimension
Fifth Life: Scarlett
Fight the System
Fight To Live Another Day
Fighter's Journey In Pokemon World
Fighting Back The Tide
Fighting Fantasy
Fighting Fate
Fighting for the Lord of Earth
Fighting God
Fighting to be Kind in a Cultivation World
File corrupted
File's Cor
Filii Aquilae
Filth: Soiled Destiny
Filthy Casual
Final Bloodline
Final Boss
Final Destiny Online
Final Earth
Final Hour
Final Light
Final Monarch
Final Quest: Restore The Lost Data
Final Rebellion
Final Stand
Final War
Final War: Entomons
Finally a competent lord
Finding Destiny
Finding Freja
Finding Home: The Quest for Knowledge
Finding Inner Peace In A Cruel World
Finding Magic
Finding Stardust
Fingertips
Finley- Diary Entries
Finley- The Lost Prince
Finley- The Lost Prince (Rewritten)
Finn Cambridge…Pokémon Master?
Fiona's Tale - the fourth and final chronicle of the Children of the Bear
Firakha - Of Monsters And Gods
Fire and Blood
Fire and Shadows. Legend of the breaker.
Fire Away
Fire Breather
Fire Emblem: Blazing Sword
Fire Emblem: The Lion's Blade
Fire Heart
Fire in the Blood
Fire Lord Seti
Fire Mage
Fire of a Dragons Heart
Fire Rider
Fire within
Fireblight
Firechaser
Firefall
Firescale
Firestorm Monkey
Fireteam Delta
First
First & Last
First Academy
First Bite
First Contact
First Contact - Book 1: WarpStar
First Death
First Death: A LitRPG Apocalypse
First Galactic War
First Love
First Of My Kind
First RE:Guards
First Vampire
First Waves
First World of an Idle Dreamer
Fishing Priest
Five Elements Academy: A Tale Of Magic
Five Knives
Five souls, 1 body
Five Squared
Fixture in Fate
Fixture in Fate — Dark Superhero Fantasy
Fjorgyn: A Rebel Rises (Complete)
Flags of Rebellion
Flame Beneath The Snowfall
Flame Heart [Dropped]
Flame of Desire
Flame-Eyed Immortal
Flames of Dawn
Flames of Divinity
Flames of Lethe
Flames Within the Heart
Flaming Light
Flaming Phoenix
Flash Step
Flashback: Siren Song
Flavour
Flawed Teeth
Flawsome
Fleeting Flight
Flesh and Iron
Flesh and Metal
Flesh runes
FLESH: Distorted Soul
Fletch!
Flick Jumper
Flight of Icarus
Flight of the Princess Sage
Flight of the Princess Sage [hiatus]
Flock of Doves
Floraling Secret
Floriena: The Start of a Journey
Flow
Flower Fit for a Vampire
Flower Girl
Flower in Ice
Flowered Metal
Flowered Metal (Rewrite in progress, check earlier chapters)
Flowers Before the Dragon
Flowers Bloom from Battlefield
Flowers change
Flowers From a Dark Lord's Fall
Flowers on a Broken Path
Fluff
Fluff-san in the Human World?
Fluffy Tails and Horned Heads
Fluvia Dellarose was an Otome Game's Villain
Fly in Fantasy
Fly With Us
Flying City of Lavender : Search for the Humanity
Fodder
Foe of Reality
Fog of War
Folgore
Follow the Reaper
Follower Of Death
Followers of The Way
Folly
Folly of Heroes
Food Life
Food Revolution in the other world
Foodie's Enigma
Fool's paradise (dungeon novel)
Fools of Fate
Football System
For a Just Cause (Restart Book 1)
For Adult Only (FAO)
For All In Thy Hands
For February's Rain
For Glory
For Grass and Glory
For I Am Legion
For I will…
For Irision
For Irision - Book One Complete!
For Justice! - A Tale Of Paladins And Hammers
For Perverts Only
For Queen and Country [An Interactive Novel]
For the Hoard
For the Man who had Everything
For The Right Price
For There is Will
For Verania!
For whatever reason, I seem to have reincarnated.
Forbidden Book
Forbidden Destiny
Forbidden Knowledge
Forbidden seduction
Force Invasion
Force Magician in Another World
Force of Change
Force of Nature
Forced Hero
Forced Immortality
Forced to be The Villains
Forcer By maskdragon
Foreigner, Journey in a different Kosmos
Foreigner: Journey in a different Kosmos
Foreshadow
Forest
Forest & Human Translator
Forest Born
Forest Dungeon
Forest Dweller
Forest of Ore["Orest"]
Forest of puns (short story)
Forest of Shadows
Forest of Teeth
Forest Queen
Forestborn
Foreststorm
Forever
Forever Alone: Trinity Blade Online
Forever at Her Side
Forever Beyond Forever
Forever Online - Wanderer
Forevermore
ForeverQuest Online
Foreworlds: A LitRPG story
Forge of Destiny
Forge of Heroes and Legends
Forge thyself
Forged in Fear and Fury - An Apocalyptic LitRPG
Forger of Fate
Forgetful
Forging a Digital History
Forging his own destiny
Forging The Beastmen
Forgive me, I didn't mean to take that!
Forgiven
Forgoing Hope
Forgotten
Forgotten Conqueror
Forgotten Dungeon
Forgotten Emperor
Forgotten Era, Book One: A Bloody Tale
Forgotten Heroes
Forgotten Kingdom
Forgotten Memories
Forgotten Necromancer
Forgotten One's
Forgotten Pages
Forgotten Quest
Forgotten Realms: Reincarnation of The Devil
Forgotten Realms: The Devil
Forgotten Reincarnation in another world
Forgotten Relic
Forgotten Undead
Forgotten Weapon of War
Fork This Life!
Former Demon Lord's Travels
Former Ice Princess
Forsaken
Forsaken Blood
Forsaken Core: Awakening
Forsaken Earth
Forsaken Hope
Forsaken Reincarnation: I Will Be A Loner No More!
Forsaken Soul
Forsaken Talents: A Dark Path
Forsaken Warrior - A LitRPG Adventure
Forsakendeva
Forsakens' World
Forsakens' Worlds
Forsaking Reality
Fort Geranium
Fortress Seven
Fortuitous Mage
Fortuna in Theatrum
Forward is The Day
Foundation Master
Foundations of Magic
Founding Eden
Founding of Humanity - Animalist
Fountellion in The Spiral (kindle) - The Nature of the Game & Progression One
Fountellion in The Spiral - Progression One
Fountellion Sessions in The Spiral
Four Days
Four Goblin Brothers
Four Miles
Four of Fools - The Deck of Fate
Four Rhytm Across The Blue DJ - Fly For Once More
Four times I've died, the fifth was intentional
Fox girl in another world
Fox Tail
Fox With System
Fox's Tongue and Kirin's Bone
Fox-girl Reincarnation
Foxes among Wolves
Foxglove Fantasy
Foxholes and Fairytales
Foxxy girl in another world
Fracture
Fracture: Tales of the Broken Lands
Fractured Horizons
Fractured Stars
Fractures: A City Asunder
Fragility
Fragment of Space
Fragmented Reality
Fragmented Realms
Fragments
Fragments Of Aeon
Frame of Mind (Fae Mythos: Gar Darron 1)
Framework: Monsters & Legends
Framework: Monsters & Legends
Frankenstein (of a sort): There Will Be Musical Parts
Fratres Per Noctem
Frau NoSur
Frayed
Frays in the Weave
Freddie Weasley
Free
Free Characters For Others
Free Empire Online
Free Fanfic ideas
Free Flight
Free To Play
Free World Online
Free: An Unbound Soul
Freedom
Freedom : shadow of sins
Freedom Fantasy
Freedom in the New World
Freedom Online
Freedom Universe
Freedom: Virtual Reality Evolved - (Codename: Freedom Trilogy)
Freeform
Freelance Saga
Freestyle [DROPPED]
Freewalker
Fresh Blood
Fresh Spawn
Freude (Hellsing Ultimate/RWBY)
Freya
Friction of the Radical
Fridays (Continue) Online
Friend Of Beast, Enemy Of Man
Friend?
Friendly Neighborhood Necromancer
Friendship Overload
Frigid Influence
From A Delinquent To A God in 10 Minutes
From a Neet, To The Emperor's Wife, To.....Eh, The Demon Overlord?!
From a phoenix to a dragon
From a World of Fantasy to a VMMORPG
From an Endless Time and a Countless distance
From Bards and Poets
From Beast to Man and Back Again
From beyond The Veil
From Boy to Man
From Chief to the Emperor
From Chief to the Emperor (Rewrite)
From cripple to hero!
From Death I am Reborn: Chaos will Follow
From Dreams to Magic
From Dreams To Reality
From Dust
From Earth to Xianxia world
From Evil Overlord to NPC Shopkeeper
From farm to MMORPG world
From Fire: Birth
From Fish to Dragon
From FPS Game to Another World
From God to goblin
From gun to sword
From My Enemy to My Love (bxb)
From Normal Student to Strongest Being
From nothingness
From One War, To Another
From Paladin to Pawn [HIATUS]
From RPG-like World to a Xianxia World.
From Sanity to Calamity
From Sun to Shade
From the Ashes
From The Black (dropped)
From The Black Abyss: A New Frontier
From the Dark, Comes Life
From The Earth To The Sky - A Short Story Collection
From the Final World
From the ground up
From the Moon: Home
From the Underworld
From The Womb Of The Either
From Vampire to Paladin
Front Tide
Frontier Crisis
Frontier of Blades and Walls
Frontrunners
Frost
Frost Dragon Cultivation
Frost Iron Forge
Frostbite - A Kammi Kettu Fan Story
Frostfall
Frostwell Paranormalcy
Frozen Armies
Frozen Ascension
Frozen Homes
Frozen in time
Frozen Soul (Completed)
Frustrated godly gaming
FT next gen
Fuji
Full Breath (Avatar Fanfic)
Full Moon at Daybreak
Fun and magic
Fun in Other Worlds
Fun Then Fire
Fun With Abduction
Fury
Fury: Book One of the Titanomachy
Fury: Chronicles of the Titanomachy
Fused Power
Fusion
Fusion dungeon
Futa Monster Girl Trainer
Future Magic
Futuristic
Fuuko: The Fox-Masked Hero
Fyhakkt
Für Elise
G. D. C.
G.E.A.R - The Study Of Nanomana
G.E.S.S. (The phoenix project, book one
G.E.S.S. (The phoenix project, book one)
G.O.D System
G.O.D.S - Great Overlords Dominating Stuff
G.O.D.S. : A Gamelit/Xianxia Novel
G.R.I.M - This Grim Game Of Ours
G.R.I.M - This Grim Journey Of Ours
G.R.U.U.U.L
Gabriel "The Bastard Son"
Gacha Doorkickers
Gacha System
Gachapon!
Gaea : A World of Miracles
Gaethea
Gaia : Legend of Merlin
Gaia Ark
Gaia Awakens
Gaia Campaigner
Gaia's little Gamer
Gaia's Shield
Gaia's will and challenge
Gaia- Legend of CC
Gaiana: Season One
Gaijin
Gainers: The chronicles of The Nexus
Galactic
Galactic Economics
Galactic Fist of Legend
Galactic Games
Galactic Internet: System Initializing Book 1
Galactic Intervention
Galactic Privateer
Galactic Schizm
Galactic Showdown!
GALACTIC Volume 1.5: Brimstone
GALACTIC Volume 1: Truth
Galactic Waltz
GALACTIC: Myth, Magic, and More
Galal: Horde Master
Galataea Crystallim: Chronicles of the Lonely World
Galataea Crystallim: Redux
Galaxia: A Modern Fantasy! [DROPPED]
Galaxy Wars
Galaxy Wars: The Legacy of Light and Darkness
Galaxy's Forge - LightHammer Chronicles: Book 1
Galbadia Prime Online
Gallanor (On hiatus)
Gallinus
Gambits
Gamble
Gambled World
Gambler's Fallacy
Game Change
Game Changer - Day Dreams
Game Changers
Game Cheater Reincarnated
Game Makers
Game Master - Unlocked
Game Master - Unlocked (Terror Infinity)
Game Master - Unlocked (Terror Infinity) (Old Version)
Game Master - Unlocked [Terror Infinity]
Game of apocalypse
Game Of Cards
Game of Death Gods
Game of Hell
Game of Reality
Game Of Souls
Game of the Mad God
Game of the Year
Game of Thrones FANFIC: Lycan
Game of Thrones/ASOIAF: King Business - Tommen OC/SI
Game of Thrones: King Business - Tommen OC/SI
Game Of Thrones: Season 8 - The Right Way
Game of World's Heroes
Game On
Game On!
Game Over
GAME OVER a daily life of a video game boss
Game Over. New Game.
Game Over: Rise of the Gods
Game Start Cancel
Game systems abilities in a fantasy world
Game world or A different world?
Game, Set, Match
Game... Over?
Game? Second autumn
Gamed:Last Attempt
Gamemaster
Gamemaster's Adventures in another world
Gamer
Gamer Girl
Gamer God
Gamer Kind
Gamer of the Dead
Gamer of the Dead (Europe Edition)
Gamer of the Martial World
Gamer of the Martial World [indefinitely postponed]
Gamer's Guide to Waking up as a Dinosaur
Gamers App
Games of Gaia
Games of Galdric
Gameworld
GameWorld: Earth's Apocalypse
GameWorld: Genesis
Gaming God
Gaming King
Gaming Paragon
Gaming The System
Gaming the Tower
Ganda'lfr – The Left Hand of God
Gangrene: Better Fed Than Dead
Gantzer
Ganymede Privateer
Garden of Ash
Garden of Gnosis
Garden of Paper
Garden of the Southern Lady
Gardener of Immortality
Gargoile found the library tower
Garth Online
Gaslgiht
Gast Academy: The Viridian Vipers
Gate Between Fantasy
Gate Guardian - Song of the Frozen Soul
Gate Guardian - Tale of the Blazing Heart
Gate keeper
Gate of Evolution
Gate of Spirits
Gate to Utopia
Gate: War of Two Worlds
Gate: War of Two Worlds Part 1
GATE: War of Two Worlds Part 2
Gate: War of Two Worlds Shorts
Gatekeeper
Gatekeeper of Death
Gates of Doom
Gates of the Gamer
Gateway
Gateway To Hell
Gateway to Nexus (Dropped)
Gattican Drive
Gears Of Rust (Abandoned)
Gecko
Gehenna's time ( Hiatus )
Geist
Gem Wars - The α crystal
Gemini: A Fox Tale
Gemma Go Home
Gems of Fate
Gemstone Goblins
GemZ: Chronicles of Le'Tayah
Gender Bender Superheroines: The Reliquettes!
GENE Project: Path to Perfection
GENE Project: Road to Perfection
General of Darkness
General Wife of Dark Emperor: Slow Witted Miss/Droped/
General Wife of Dark Emperor: Slow Witted Miss/Dropped/
General's Call
Generals of the Apocalypse
Generation Militia
Generation: Alpha
Generic Fantasy
Generic Isekai Cultivation Wish Fulfilment Power Fantasy
Generic System Apocalypse
Generic Zombie survival Wuxia Cliche story
Generika 0Ffline
Geneseed
Genesis
Genesis 5.0
Genesis Accord
GENESIS PRIME- New Beginning
Genesis Wave
Genesis | Book 1 of Rise of the Paragon
Genesis | Book 1 of Rise of the Paragon - A Post-Apocalyptic LitRPG
Genesis: Journey of the Creator
Geniecide: Genie's First Law
Genius has an Infinite Capacity
Genjitsu no Kyoukai
Genjutsu Made Real
Genophage (Liber Telluris Book 1)
Genre : Fantasy
Genso Suikoden: Worlds Collide
Gentle Dragon Edmond
Gently Tormented
Geo's travels through an unfamiliar continent
Geo's travels through an unfamiliar continent V2
Geomancer
George Brown and the Uth Stones by Duane L. Ostler
George of the Dungeon
Gestalt Hope
Getting a Common Game Ability on Normal Life [Revised]
Getting big in the Big Blue
Getting Hard
Getting isekai'd with my Boy!
Getting power IRL is expensive
Getting reborn as an Orc
GG Newb- A LitRPG Saga ($200 in prizes! Naming contest!)
Ghastly Adventures
Ghibli Gang - Where in the world are we?
Ghost alchamist's sinister witch [dropped]
Ghost Girl, Ghost Girl. She Gonna Take Your Soul!
Ghost Gods - Harem Book
Ghost of the Uchiha
Ghost World Academia
Ghost World Academia (Discontinued)
Ghost World Academia (Remade)
Ghostified City
Ghostly Bodies
Ghosts in the Dark
Ghosts in the Glass-- A Lesser Dark: Book II (Complete)
Ghosts in the Glass-- A Lesser Dark: Book II (Second Edition)
Ghosts Over the Forest
Ghosts Within
Ghostshift
Ghoul Rising by(Tailspindark)
Ghoulish insanity
Ghoulish insanity (incomplete/finished)
Gi: Imera
Giant Eater (LitRPG)
Giants and Demons
Giantslayer
Gift of Mercy
Gift of the goddess
Gifted
Gifted Eyes
Gifts From Morpheus
GIG: God In Gold
Gilded Age
Gin: A pint of London's finest (Litrpg)
Gina the goblin, Dungeon Extraordinaire
Girl Who Survived The Madness
Girl with the Golden Eyes
Girl with the Golden-Cat eyes
Girls, Go Away!/ Baka Koi!
Give me a word I'll make a world
Glacierwaif Act 1: Homefront
Glacierwaif Act II: Crucible
Glass Arrows
Glass Cannon
Glass Cannon - the Search for Synergies
Glass Cannons
GLASS || The Catalysts Series, #1
Gliese
Glimmer, A Throne of Souls (An RPG Gamelit Novel)
Glints Saga: Dove
Glints Saga: Dove – The Story of a Wayward Magical Girl
Glints Saga: Papillon
Glints Saga: Papillon - The Story of an Ex-Magical Girl
Glints Saga: Vanilla
Glitch
Glitched Amazon; Ghosts Only Die Once
Glitchworld Ground Zero
Gloam: The Sin-Eater
Gloom and Doom: Short Stories
Gloomhaven: Glorious Gatherers
Gloominess +1
Gloominess +4: The Cradle of Gods. A LitRPG series: Book 4
Gloria [diviners Diary]
Gloria Infidelis -Glory Beyond the Madness-
Gloria: A Dungeon Delver's Story
Glorius Adventure Online
Glory be to Arria
Glory Hole Adventure
Glory Of The Hunt
Gloryhound - The Story of a Wizard's Assistant
Gloryland
Gluttonous little crow
Gluttonous Prince
Gluttony
Gluttonys Reign
Glyph
Glóaming of the Gods
Gnawing Hunger
GNO arms GNO problem!
Goal of a Cultivating Beauty
Gobbo
Goblin
Goblin Artist
Goblin Combe
Goblin Conqueror
Goblin Flood
Goblin Kingdom
Goblin Lord
Goblin Mage
Goblin Memory
Goblin Musicians
Goblin Plane
Goblin Progenitor
Goblin Rebirth
Goblin Reborn
Goblin Rising
Goblin's Evolution
Goblin's Glory
Goblin+
Goblin: Tower of Gates LitRPG Book One
God
God Among Men
God Among the Cats: Nya Tribe Dominance!
God Among The Monsters
God Amongst Cultivators
God Blade (Hiatus)
God Chef Rordon Gamsay
God complex
god Dimension
God Dragon Emperor
God Era
God Farmer
God in Deep
God Is A Game Designer
God isn't dead, He's just broke
God Killed Me
God looking for love
God Must Be Lazy He Allowed a Cultivation Anomaly
God Noise: Volume I
God of All Element
God of all System
God of Chaos
God Of Cheat
God of Crows
God Of Destruction
God Of Disaster
God of Evolution
God of Exemplum
God of Eyes
God of Fear: The River's Wrath Saga
God of Gnomes: Book 1 of the God Core series
God of Heroes [GoH]
God of Infinity
God of Magic & Martial Arts
God of Magic and Creation
God of Martial Arts
God of Mischief
God of Music
God of Nature´s curse
God of Sacrifice
God of Stories
God Of System
God of the Apocalyptic World
God Of The Arts Book 1: Captive of Alberdos
God of The Criminal's world
God of The Crows
God of the Isekai
God Of The New World
God of Virtual Reality
God of War in the Cultivation World
God of World Creation
God Particles
God Project : Blank Slate
God Realms Online
God Rising: The Cult of Ainz Book I
God Slayer
God Slayer (Vol.1 and Vol.2)
God Slaying System
God Vessel Online
God Yuje
God's Adventure
God's Beta Tester
God's Death
God's Descent
God's Diary
God's Domain
God's domain (bodyrefiner99)
God's Door
God's Eye
God's Fall Chronicles: Schism
God's fiction (CANCELLED)
God'S For Hire
God's Gambling Table
God's Game
God's Game : Player [72]
God's Island
God's Journey To Be The Best Craftsman
God's Little Joke
God's Only Child
God's Orphan
God's Return
God's Scale
God's Seekers
God's System
God's Trial
God's Trials
God's war
God's Whims
God's wrath
God's Wrath: The Dove
God, stop following me!
God, Stop that! Chaos Happened When She Became a He. [Dropped, Has no intention on continuing. The author got job]
God-Sent Anathema
God-Slayers
Goddess at the Gates
Goddess of Beauty
Goddess of Computation
Goddess of Crystal
Goddess of Death
Goddess of the Anthropocene
Goddess of the Sun and Moon
Goddess' Slave ∴ Reincarnation
Goddesses are out of Heroes, so it's up to Me to Save an Isekai World! [Poll Story]
Godefiance: Audun
Godfather and Godson
Godfather of magical technology with a pinch of exortion
Godfather of magical technology with a pinch of extortion
GodForge
Godfrey the Legend
Godhood
Godhood Online
Godhood: Info Dumps
GodHunters
Godlea: World of Creations
Godless
Godlike
Godlike Reborn
Godling
Godlings
Godly Otaku Divine System
Godly Otaku System: A Gamelit/Xianxia novel
Godly Otaku System: A Gamelit/Xianxia novel (Old Version)
Godly reincarnation
Godly Stay-Home Dad
Godly System
Godly Voice In Another World
Godmaker
Godmaker's Gem
Godpunk: A Tale of Swords, Sorcery, and the No-Good Journalist Who Saw It All
Gods and Creators
Gods and Glory
Gods and Men: A litRPG Adventure
Gods and Worlds
Gods Are Watching
Gods Be Wary
Gods Conqueror
Gods Game
Gods How I Hate Nature
Gods of Space
Gods Of War: Between Elves and Humanity
Gods' Game
Gods, Monsters, and a Fuzzy-tail
Godsbane
Godsend
Godsfall (Ash Drake Series)
Godslayer
Godslayer (Krndark)
Godslayer (WizOFTime)
Godsmith
Godstone
God´s Games
Goes Unpunished
Going Against The Ordinary
Going Back Into A Distant Past
Going Home
Going Home (and other day-time delusions)
Gokaiku: I Got Reincarnated, But It Wasn't How I Thought It Would Be!!
Goku And Saitama'S Ability With Demonic System In Different World
Gold 'n Green
Gold Inc.
Gold Over Gods
Golden Age
Golden Draconian
Golden Dragon's Ascension
Golden Fox with System
Golden Horde
Golem
Golem core
Golem Creator
Golem Power Armour
Goliath (a Litrpg novel)
Gone Rogue, Arc I: A Fool'S Errand
GoO - Game of Origin
Good Demon's War
Good Evil
Good Game
Good Morning World
Good Morning, Mr. Kay
Good or Bad. What's the difference?
Gotta Gacha
Governor
Grace'S Predicament
Grahlgar the Ogre
Gram Bloodfeast: Retired Warlock
Grand Adventure
Grand Arcanist: A Warcraft(Fan)Fiction
Grand Design
Grand Dream Online
Grand Fantasia Gates - He who Bled
Grand Mage learns to bake
Grand Magus
Grand Paladin
Grand road
Grand Simulation
Grand Summoner
Grand Weaver: Renewal
Grandma, let's form a party!
GrandMaster Dao
Grandpa Sweet Fist
Grandpa Universe In Multiverse
Grandsmith - Art of Forging
Granny God-mode
Grantale Online
Graphomurk
Grasping Destiny (Temporary Hiatus)
Grasping for the Heavens
Gratuitous Item Crafting and Descriptions (and shoddy economics)
Grave of Heroes
Grave Of The Goddess
Graveborne
Gravecrawlers
Graven
Graves
Gravestone (Dropped)
Gravitas
Gravity
Gray Color HoC
Gray Hour: The Cursed Coin
Gray Mage: The Alchemist
Gray Wolf.
Gray's Crucible
Grazing the Sky
Great Ascension to Godhood
Great Dragon Emperor
Great Green Empire
Great interdimensional war
Great Martial King
Great Master of All
Great Red Revolution
Great sin
Great Tyrannical Deity
Great War of Cheater! Another World Strategic Warfare
Greater Beyond
Greatest Gamer (Dropped)
Greatest God Li Ma
Greatest Superhero
Greatest Xianxia Book
Greed
Greedy Bastard RPG
Green 'n Gold
Green Life
Green Mountain
Green Sky
Green Tea Sea
Green Tea Sea - A Grand Eye Tale
Greenblood
Greenskin
Greenvale Fairy Tangle
Greg Veder vs The World
Grey
Grey [HIATUS]
Grey Eyes
Grey Mage
Grey Worlds
Greyblood
Greyblood: Progenitor (A LitRPG Series)
Greyblood: The Liar in the Fog
Greyskin
Grieyes Mages - Unknownly Superior Type Magician
Grim Ether
Grimdark Ash: Twisted Fantasy
Grimm
Grimm Darkfyre -- Darkening Dungeon
Grimm Lord
Grimm, The Mythical Detective
Grimmblood Volume 1.
Grimoire
Grimoire Bound
Grimoire Knights
Grimoire's Soul
Grimoire: Retake
Grimsly Elegy
Grimstone
Grimstone: A Dark Gamelit Western
Grimstone: A LitRPG Weird Western
Grimy Sunlight
Grin the Cheat
Grinding in Vast Martial World
Grinding Levels on Ossunica
Grinding to Become a Protagonist
Gris Evighet
Grissla the Witch
Grocery Bag
Grow
Grow: A Scourge Wars Web Serial
Growing Puppets
Growing Strong
Growth
Growth Log of a Blackhole
Guanyin's Journey to the West
Guarded
Guardian
Guardian Heroes
Guardian Of Nature
Guardian of the Oracle
Guardian of Wicked Sphere
Guardian Online
Guardian Reincarnation
Guardian's Folly, Dryad's Melancholy
Guardians Awakened
Guardians by Design - Land
Guardians of Midgard: The Legend Begins
Guardians Of The Helm
Guardians of Times to be
Guardians Will Fall, Heroes Will Rise
Guardium
Guerdon
Guerra Moderna en un Mundo de Fantasía
Guess I'm a God now
Guess I'm a spy
Guidance
Guide to Conquering the World of Magic (Cultivation, LitRPG, Isekai, Yandere)
Guide to Survival in Another World
Guiding the Way
Guild App
Guild of Thieves
Guild Wars
Guild Wars: Brutality
Guilder Story
Guildmaster
Guilty x Creatures
Gun Elf
Gun Meister Online 2
Gun Meister Online [First Draft Complete]
Gun X Princess
Gun x Waifu
Gunbreaker
Gunrunner
Gunslinger and Samurai
Gur-dun: Grey's Selection.
Gura Gura no mi Cultivator
Gvera Cross Extras
Gwenn Mordredae
Gwyn's Pet Life
H A L F L I F E
H x Alien (Web-Novel)
H(e)aven
Ha'suru Lab Life!
Habitat
Hack Alley Doctor
Hack and Slash (LitRPG)
HacKer;Deep Veiw
Hacking Reality
Hacking Reality (A teenage Mad Scientist's story.)
Hades XII
Hai! My name is Satan!
Hail Storm
Hail The Emperor
Hail the King
Halcyon Undead
Halcyon's End: A Reincarnation Story
Half a God
Half a Heart
Half a Step Away from Love
Half Breed
Half Breed Haven: A Hot Time At The Ol' Lucky Seven
Half Demon, half human.
Half Dragon
Half Mind, Full Legend
Half Shaman
Half Step
Half-Blind Master(temporary title)
Halfway to Home
Haliel's Adventure
Hall of the Immortals
Hallowdash
Hallowed
Halloween Specials
Halloweenish Project Time Lapse
Halo: Ascendance (Book One)
Halo: Spartan-021
Halo:Nightstalker
Halvard's Chronicle
Hammer of Order
Hanami
Hands Held in the Snow
Handsome Glock
Handyman
Hanging on Bones
Hanging out with the Mutants
Hangman
Hannah Forteza and her Forte Persona
HANNIBAL: Season 4 (Book Continuation)
HANNYA ' The Curse of Revenge''
Hans Pötterman and The Prisoner of Stalingrad
Haphazardous Debugging: Adaptation
Happiness System
Happiness!
Happy Dragon
Happy Ending
Happy Ever After
Happy Facility: Origins
Happy Fantasy World
Happy Happy Fun Time
Harbinger Of Chaos
Harbinger of Destruction (an EVP LitRPG)
Harbinger of Havoc
Harbinger of the Damned
Hard Bargain
Hard Bargain - Discontinued
Hardcore Dungeon Core - A MMAG spinoff.
Hardcore HELL
Hardcore Online
Hardcore OP-ness
Hardcore: Qi Worlds
Harder. Better. Faster. Stronger
Hardmode
Hardwork(a naruto fiction)
Harem and Empire
Harem In Another World
Harem infinity
Harem King
Harem Reaper
Harem Trash: A litRPG Satire that No One Asked For
Harems Are Evil!!-REVAMPED
Harems are only for wimpy guys?
Harmony
Harmony: An Assassins Tale
HARP;Lunatic
Harper's Blues
Harrow
Harry Gamer (Revamp)
Harry Potter - Book 1 - Arrival To The Harry Potter World As a Villain!
Harry Potter - Demons in the Sky
Harry Potter and The Dark Lord
Harry Potter and the Dark Phoenix
Harry Potter and the Dark Phoenix [Rewrite in Progress]
Harry Potter and the Fourth Member
Harry Potter And The Immortal
Harry Potter and the Insert of the Self
Harry Potter and the Might of Atlantis
Harry Potter and the Planar Sovereign
Harry Potter and the Wallbanger
Harry Potter: and the Book Dweller
Harry Potters Second Chance
Harry's New Hobby
Harry-Stu Gamer by Zed019
Hartfield Chronicles
Hartwright Vampires
Haruhism of a Lesser
Harukaze 春風
Harukaze 春風 V2
Harvest Factory ~ a Farmer Life
Harvester Wolf
Hateful Sin
Hatena360: Shira's Story
Hater
Hatred: The Journey of the Madman [Old]
Hattie
Hattie: An Old Maid's Adventures
Hattoran Chronicle
Haunted
Haunting Lies
Haunting My Boyfriend
Have Scythe, Will Travel
Haven
Haven : Eldritch Knight
Haven Chronicles Book One - Eldritch Knight
Haven in a Dangerous World
Haven in a Dangerous World (Old)
Haven seeker: Rogue one
Haven: The Sky Scraper
Havenbrook [Editing]
HavenFall (Thousand Lands)
HavenGuarde
Having a Common Game Ability In Normal Life
Hawkin the Brewer.
Hayato the Chibi who became a Great Demon King
Hazard Frontier
Hazard Lands (Dropped)
Hazard Online
Hazardous Debugging: Reanimation
He Came From the Forest
He Who Came From The Abyss
He Who Fights With Monsters
He Who Fought The Gods
He Who Have Sinned
He Who Sits on the Throne
He Who Slays by Stevenoth: Discontinued
He Whom is Abandoned
He's The One™
Headpat Bot!!!
Headpats
Heads Will Roll
Heal Die Cry
HEAL: In Calamity, Terra & War
Healer
Healer Prime
Healer to Blood Knight
Healers Path
Healing Luck (Rota Rising Book 1)
Hearkened when he was Young (A Roman SI)
Heart Cores have hobbies (HIATUS)
Heart of a Dungeon
Heart of a Mer
Heart of a seagull
Heart Of A Servant
Heart of Borneo
Heart of Courage
Heart of Creation
Heart of Cultivation
Heart of Fire
Heart of the Dungeon
Heart of the Forest (Hiatus)
Heart of The Home
Heart of the World
Heart of the World (LitRPG)
Heartful
Hearth of the mountain
Heartless
Hearts Of Rust {BL}
Hearts Of Rust {Revenge BL }
Heartscale
Heathens
Heather the Necromancer
Heaven and Hell
Heaven Chronicles: Raven rising (A LitRPG adventure)
Heaven Cry
Heaven Falls
Heaven Immortal Promise
Heaven Made Travelar
Heaven of the Dream Fantasy - Going for a pacifist record
Heaven of the Dream Fantasy - Going for a zero-damage record
Heaven Sealing Art
Heaven Trial
Heaven Vs. Hell: Curse Of The Water Prophet
Heaven's App
Heaven's Awakening
Heaven's Brush
Heaven's Cry
Heaven's Daughter
Heaven's Emergency Exit
Heaven's Fall
Heaven's Flute
Heaven's Grip : Orcs of Iaoue
Heaven's Oddity
Heaven's Will
Heavenly Blood Monarch
Heavenly Dao Of The Sword
Heavenly Domination
Heavenly Goddess
Heavenly Hollow Rhapsody
Heavenly Mage Shura
Heavenly Martial Harmony
Heavenly Paragon
Heavenly Rebirth - The Martial Hero's Journey
Heavenly Sovereign
Heavenly Will
Heavenly Yang Emperor
Heavens and Flames
Heavensborne: The Fall
Heavenward on Golden Wings
Heavy Metal: A Cyberpunk Novelette
Hegemon
Heidi's Son
Heimdall
Heinous - The tale of an unusual necromancer
Heinous - The tale of an unusual necromancer (dropped)
Heir Apparent
Heir of Brimstone
Heir of Brimstone (A Grimdark Cultivation LitRPG)
Heir of Mana
Heir of the artificial Gamer system
Heir of the Divine Phoenix
Heir of the Dragon
Heir to a Lost Sun
Heir to Insanity
Heir to the Eternal Throne
Heir to the Throne
Heir's Fate
Heirs of Creation- A Supernatural Fanfic
Held in the Quiet Night
Helden's Keep
Heleg en Eryn [ GERMAN / SINDARIN ]
Helena's Plane
Helix Academy of Superhuman Development — A Superhero Fiction
Helix: a technothriller
Hell Bound The Ancient Ones Series
Hell Fighters
Hell Knight
Hell Knight: Fall of Man
Hell Mode Hogwarts
Hell of the Dead
Hell on Earth [You Decide What Happens]
Hell Pawn
Hell's Dungeon
Hell's Embrace
Hell's Finest
Hell's Insanity
Hell, Sweet Hell
Hell-Bound
Hellacious
Hellborne
Hellbound
Hellcrashers
Heller: New World
Hellfire Across the Heavens
Hellhound
Hellhound and His Witchy Mate
Hellish Ascendance
Hellish: Misfit Misadventures
Hello Troublemaker
Hello, You're Through To Hades, How Can I Help You Today?
Hello..Main Character
Hells on Earth
Hells Pit
Hellspawn
Helm.Online
Helmer's Theory: A Butterfly Effects
Help I'm a Pathfinder Commoner trapped in a Game world.
Hemocyanin
Hemocyanin - DISCONTINUED
Hemophobia
Henchman
Her Black Soul
Her Fragmented Mind
Her God of War
Her Highness Only Wants To Train
Her New World
Her Rage
Her Secret
Her True Form
Herald of the Night
Herald of Tomorrow
Heralding Fruits
Heralds of the Dark Age: Hound of Sorrow
Here Be Cowboys
Here Comes the Reaper
Here I Stand (Stand User Si)
Here there be monsters
Here There Be Pirates: The Dragon and the Bear
Here we go again
Here's Our Princess, Take Care Of Her! (And Don't Get Killed By The Dragon)
HereAfter: Dragons Fall
HereAfter: Dragons Rising
Heretic King
Heretic's Wrath
Heretic: Unbound
Heretical dungeon
Hermit in the woods
Hero
Hero aiming to be the next Demon Lord concurrent
Hero Chronicles:
Hero City
Hero Demon Synthesis
Hero for hire
Hero Historia: Jericho Rising
Hero Hunter
Hero Hunter: A superhero litRPG
Hero Hustle
Hero In A Monster Academy
Hero Is Now Villain
Hero Kids Online
Hero Kids Online II, The Ghost Pirates
Hero Land
Hero Of Demons (Hod)
Hero of Edea
Hero of Hsura
Hero of Naught (Original edition)
Hero of Nierrath
Hero or Demon Lord?
Hero or Fool
Hero or Monster
Hero or Villain?
Hero Scout
Hero Status: Revoked
Hero Status: Revoked - Rewrite
Hero summoning ?? NO... it's are free soldier summoning !! (Discontinue)
Hero's Ballad
Hero's breaking
Hero's Call
Hero's Exodus
Hero's Gear Online
Hero's Symphony
Hero's Tale: A Tragedy
Hero's Trouble; How did i end up as Hero?
Hero, of the Locus (stillborn attempt, rewriting)
Hero:Generation
Hero? Again? No Way
Hero? I'm assassin, but that's the same right?
Hero? Nope I'm their child
Heroes & Harmony
Heroes & Villains
Heroes and Ancients
Heroes and Villains
Heroes Die First
Heroes of Bloodshed
Heroes of Erathia
Heroes of Errand
Heroes of Jorg
Heroes of Midlaris
Heroes of the Collapsing World
Heroes of The Collective
Heroes of war
Heroes Online - Rosy Undead
Heroes Online : Against The Darkness
Heroes Return
Heroes Wanted
Heroes' Burden
Heroic Age
Heroic Chronicles Volume 2: Dawn of the New Beginning
Heroic Necromancer
Heroics of an Overlord
Heroine? Yeah, no.
Heroism and Bad Decisions
Heros Of 21st century !
Herrscher der Nacht
Hestheria
Hexarchy
Hexarchy: Tainted Earth
Hexen
Hexes for Exes
Hey, Hero Killer!
Hi Effort Writer
Hi, I'm Susan and I drive trucks for the Isekai Dao Displacement Department
Hi,I'm Everything.
Hidden
Hidden Abilities
Hidden Adversary
Hidden Darkness, a Star Wars story
Hidden Deity Of Destruction.
Hidden Forge: Lucem Ac Tenebras
Hidden Forge: Lucem Ac Tenebras (Rewrite in Progress)
Hidden Magics
Hidden Sins
Hidden Words
Hidden World
Hide and Aizawa
Hide out
Hidra
Hidra- False Hydra story
Hierarchy of the Ecumene
Hierohn
Higanbana
High Artificer
High Class Boy... Causes Problems In High School
High Crew
High God
High Lord Calamity
High School DEATH GAMES
High school life in a world where everyone has superpowers
High School of Magic and Weaponry
High School with Humans
High Skies Piracy
High Tech System
High Tides to Low Clouds (ft. Miss Catherine)
High-Class Mob
High-expectations and haughty thoughts
Highborn (The Stormforth Chronicles)
Higher Beings
Highschool Necromancer
Highschool Sweethearts
Hightailing It
Highway Crooks
Hiiro's adventure
Hikari Okami: Kitsune Series
Hilarity of a Game-Breaking Player [Hiatus]
Hilda Finds a Home
Hill
Him and Her - An Odd(?) Story
Him? Her? I am Two, But Two am I [HIATUS/DROPPED]
Himitsu the monster guild member
Hinterland
Hiraeth, longing for a home that never was
Hiraeth: Awakening
Hiro's Journey
Hiro's Predicament (A choice-based novel)
Hiro's Tale
His Android Wife
His Eternal Aspiration
His Imperial Majesty, the Empress is a Venomous Fairy!
His Insanity: Time Traveling in Another World
His Lordship
His Love |Hisoka fanfic|
His Majesty's Harem
His Majesty's Immortal Academy
His Whispers
Historian
History of the Orcs According to, The Beginning: Breath Of War
History Repeats
History's Strongest Disciple Fanfiction
Hit It Very Hard
Hit The Road, Jack!
Hive - Locked Up In Space
Hive Consort
Hive Evolution
Hive Knight: Trinity of the Hive Book One[Completed]
Hive Mind
Hive Prince: Trinity of the Hive Book Two[First Draft][Hiatus]
Hive Queen
Hivemind Overlord
Hoard of War
Hoarfrost Wintertide
Hodgepodge
HofN original
Hold or Fold: A World Where Wagers Magically Matter
Hold the line.
Holders
Holes
Hollow Core: School of Swords and Serpents (Book 1)
Hollow Heart Journal
Hollow Moon
Hollowed Out
Hollywood Delight
Holocaust Of Saturn
Holy Emperor Satan
Holy Sword Master
Holy World
Home Turf
Homecoming
Homecoming | A Chronicles of Ascension Story
Homemade Immortal [DROPPED]
Homeward Bound
Homicidal Aliens are Invading and All I Got is This Stat Menu
Homunculi
Homunculus Factory (The Alchemist's Version)
Homunculus Factory : My Monster Girl Tower
Homunculus Queen
Honestly I'm A Good Vampire
Honey Bun: Awakening
Honey, I'm home!
Honey, I'm home! [HIATUS]
Honor of the battlefield
Hooked Up: A Magical Monk LitRPG Adventure
Hoopity Scoop: The Duck
Hope
Hope beyond the Horizon
Hope Connect
HOPE Engine
Hope for Dawn
Hope in the Dead - Alone (For you Zombie Lovers)
Hope in the Dead - Survive Alone (Zombies)
Hope Of Salvation
Hope Springs Eternal
Hope's Bastion
Hopeful Start
Horizon
Horizon Dawn
Horizon Saga
Horrific
Horror Bites
Horror from the Depths
Horrors Old and Knowing
Horsey Ashes
Host
Host Me!
Host, At Least Let the Villains Act First!!
Hot Chick with Zweihander
Hot Guy Cold Guy
Hot Springs Brigade!
Hound of War
Hound of Ériu
House Cazador: Kingdom of the Lion
House Denholm's Madman: Raising the Demoness in My Head
House Fortino: Village of Steel
House Of Crossroads
House of Exiles
House of Matchsticks
House Of Omen: Indomitable Oathbreaker
House Of Omen: The Indomitable Smithersmith
House of the Dead
House of Wolves
How a Carpenter became the strongest melee fighter of the New World
How a lame loner's life is not like normal dudes
How a Skeleton Becomes Sovereign
How can I save the world if I'm no longer the hero?
How Deep Can People Fall?
How Do Centaurs Wear Pants?
How do you kidnap a whole school of kids to another world?!!
How Do You QA Test a Tsundere Android!?
How Does One Become Strong?
How Everything Started
How Far We've Come
How I Became A God
How I became a monster
How I became a Reaper
How I became op.
How I Destroyed The Main Questline At My New Job
How I escaped being a hero
How I found Neverland
How I got Possessed By A Barrel Of Porn
How I got Possessed By A Barrel Of Porn (Paused)
How I Rule The World
How infinite is infinity?
How Is It At Taldora
How many times do I have to die? Is it really necessary?
How Much For Your Soul?
How Not to Use Magic
How Strange, I Seem To Be...
How the mighty have fallen
How the Stars Turned Red
How The Weak Live
How to "Endure" Living - Putting All Your Points Into STR
How to Avoid Death on a Daily Basis
How to avoid going insane as a body cultivator
How to be a Good Evil Overlord
How To Be Human
How To Be Successful In Another World
How To Beat The Dungeon Boss : Reimagined
How to become a Dark Lord
How to become a deity
How to become a Demon Lord
How to Become a Demon Lord in Another World
How to Become a Wizard
How to become an evil overlord!
How to Break an Evil Curse
How to Conquer the World
How to Create Adventure
How to Date an Android
How to Fake Your Own Death (Dropped)
How to get away with murder
How to get lost: a wanderers guide
How to get rich in ancient times
How To Go To Another World Manual
How to God 101
How to have fun in an apocalypse
How to Join a Cult
How to Kidnap your Princess
How to Kill an Isekai Protagonist
How To Kill Boredom (And The Gods)
How to Perform Magic and Influence Fae
How to protect a hero
How to raise a Hive Queen
How to Run a Demon World: Lesson 101
How to Save a Star
How to Survive a Summoning 101
How To Survive Hell.... Kind Of
How To Tame Your Princess
How To Tidy Up Loose Ends
How To Wear A Crown
How To: Think Properly
How to:Become an Evil Overlord
HOW TO…(now complete with a 'Run Away From Your Death Flags' version!)
How We Survived
How will the Zenith Rise
How Zantheus Fell into the Sky
Howling
Howling Thunder
Howling Wind
HP The Birth Of Darkness
HRAIN: A StarFighter Story
HS Dungeon Crawl
Huckleberry
Hui Lin: Speechlessly Cultivating
Human & [Inhuman]
Human Altered
Human Hunter
Human in a Demon's Hide
Human King.
Human Nature Never Change.
Human Not
Human Outside, Demon Inside
Human Soul
Human Spawn
Human Weaponry
Human: Tower of Gates Book Two
Humanity
Humanity Extinguished
Humanity's Hell
Humanity's Last Hope
Humanity's Next Steps
Humanos x Sistema
Humans are unstoppable
Humans Remain Wicked
Humans: A Mythical Manual
Humiliation Of A Samurai
Humiliation Of A Samurai (in progress - Chapter 8 coming soon)
Hundred Worlds
Hunger
Hunger for affection
Hungry Necromancer
Hunt and Heroes
Hunt for the ECSS Dark Phoenix
Hunter - A LitRPG/Xianxia apocalypse novel
Hunter : Surviving in the New World
Hunter Mania 「Hell And Heaven」
Hunter Markell
Hunter Or Huntress
Hunter Paradise: Rise of the Vanquished Ones
Hunter Warrior In Wuxia World
Hunter X Hunter Overgeared
Hunter x Hunter: Gon Freecs, The Multiverse Gamer.
Hunter X Hunter: Royalty and the World Beyond
Hunter's Academy "Aresia"
Hunter's Blind [Working Title]
Hunter's Bond
Hunter's Choice
Hunter's Knife
Hunter's Log
Hunter's Odyssey
Hunters
Hunters Dream Online: Ascension
Hunters Of Reality
Hunters of the Night
Hunters World
Hunting For Hattie
Hurt People Hurt People
Hush - The Sin of Man
Husk
Hvn
Hy'Ruh-Ha
Hybrid Summoner
Hybrid's Revelation: Endru's Origin
Hybrids
Hydar Celestial Imperium
Hydra
Hymn of Ignis
Hymns of Stone
Hype-phagia
Hype-phagia (hyper-glutton)
Hyperburst
Hyphen
Hyphen (Pokemon Emerald)
Hysteria (hiatus?)
Häerandar the elf who is searching for a better life
I Accidentally Stole a God
I alone fight in the apocalypse
I alone live it up
I alone live it up - HIATUS
I am a Bug
I am a Child of Two Celestial Beings
I am a Child of Two Celestial Beings (ON HOLD)
I Am A Demon Lord, Get Me Out Of Here
I am a Fish.
I am a genius so I don't need a strong cheat to survive
I am a Ghibli System
I Am A God Tree?!
I am a Guardian in another world!?
I Am A Hero: I Believe I Can Fly
I Am A Hero: In A Silent Way
I Am A Hero: Sheer Heart Attack
I Am A Mimic
I Am A Spaceship!
I am a tree
I Am an Evil Lord Yet, Why Are They Happy to Serve Under Me?
I am an inferior being with the ability to seduce women.
I Am Brand
I am but Divine
I Am Gamer
I Am Gamer Iv
I Am God!
I Am Going To Die (In This Game-Like Dimension)
I am Hulk!
I AM Human or Devil
I am in the Marvel Cinematic Universe?
I am infamous
I am Just a Farmer
I Am King: Book One (fourth draft)
I Am Legend
I am My Own Disciple
I am my own God
I am No King
I am Not A Hero
I Am Not The Main Character
I Am Nothing More Than A Mere God, Who Met a Human Woman While Searching For Peaceful Place
I Am Npc69
I am Ordinary
I Am Part Dragon (Part 1 Completed)
I Am Power
I am Prometheus
I am Stellar
I Am Supreme (Reloaded)
I am System
I Am the "God of Death", Whatever That Means. (Original)
I Am the "God of Death", Whatever That Means. (Revised)
I am the blood grove
I am the Chosen One
I am the Deathly Hallow.
I am the Doomsday Weapon
I am the firstborn of a new world...
I am the king of all villainous villian
I am the king of all villainous villian : Volume 1 : against hell devouring beast
I Am the Last
I Am The Monster
I am the pirate gamer
I am the supreme evils daughter
I am the Villian
I am too old for this shit
I Am Unstoppable
I am Urist
I am Urist (Book 1 Done)
I am.
I am...*sigh* a speck of dust.
I Am: Mud Dragon
I awoke as the hero of Oakvale
I Became a [Biologist] in a Fantasy World!
I Became A Building?
i became a Girl to win the Tournament
I Became a Legend Before I Realized It
I Became a Member of my Friend's Yandere Harem?!
I Became A MOBA Character
I Became A Vampire In Another World
I Became A Virtuous Wife and Loving Mother in another Cultivation World
I Became An Adventurer
I Became my Granddaughter Familiar!? (ReWrite)
I Became Rat!
I Became the Commander of an Army?!
I became the strongest magical tome. But I am still a teacher! Book 1
I Became the Villainess, So I Decided to Ignore the Main Characters
I Bought Some Guy's Soul On eBay
I Came Back In Order To See You
I Came, I Ran
I can cheat? So let's have fun.
I Can Hear Your Thoughts, but it's not like I'm Telling You or Anything!
I Can Respawn In The Apocalypse
I can skip between worlds!!!
I can't activate my mana, so God gave me a system!
I Can't Believe I Have the Girlfriend of My Dreams! - An Unromantic Love-Comedy Light Novel
I Can't Believe I Have the Girlfriend of My Dreams! - An Unromantic-Love Comedy Light Novel
I can't believe my fiance chose me to be her cheat when she was summoned to another world
I can't die but I want to live in excitement...(Dropped)
I Can't Own You? (BxB 💙)
I Chose Mega Schlong as my Weapon of Destiny, but Everything I Fight is a Male: A Harem Story
I Come From The Water
I Come In Peace
I could be in a coma
I Could Have Just Walked Away
I Decided To Become A Wandering God; A Record of Adventurous Newly Minted God
I decided To Live In This Messed Up World
I decided to summon an army of waifus to save the universe.
I Decided to Write a Story
I didn't actually want to change ♂♀
I Didn't Become Super Strong in Another World (Isekai litrpg)
I Didn't Even Want to Live, but God Forced me to Reincarnate
I Didn't Expect to Wake Up as the Demon Lord
I Died
I Died & Reincarnated As Wolf In A Fantasy World
I Died And Got Reincarnated Into An Isekai World As An Elf With No Mana... But With An RPG System
I Died and Reincarnated as a Plant
I Died And Was Reincarnated As The Demon King's Daughter?!?!
I Died But I Reincarnated As Myself?
I died reincarnated and died again
I died so the main protagonist can have character development, but I got reincarnated to another world - Light Novel
I died, so I'm trying again with all my stat points put into my Artistry stat!
I do whatever I please
I Don't Wanna Live My Second Life
I don't want to be a hero
I Don't Want to be a Hero! But I will fight to Protect my City! (Hiatus)(Might restart soon updated: 2-19-2016)
I Don't Want to be Evil, but You're Forcing me to be.
I don't want to be Famous!
I don't want to be the Hive Queen
I Don't Want To Be The Main Character
I Done Goofed A Funny
I Enchanted The Whole Forest
I Fell And Thus I Must Rise Again.
I Fight to Return Home
I Flew Into A Fantasy World And Got A Goddess To Use The Internet
I Gave Up Everything
I Get a Second Chance and Accidentally Become a God
I Get A System, But I'm Still On Earth.
I Got All The Spells But My Magic Stat Is One So I Became A Stage Magician But Found Out The Doom Spell Doesn't Care.
I Got Flown into a Fantasy World and Managed to Convince a Goddess to Let Me Keep a Laptop Connected to the Internet
I got nothing (I seriously don't know what to call this)
I got Reincarnated and my System is kind of a jerk
I got reincarnated as a Zerg
I Got Reincarnated as High Human with Creation Eye
I Got Reincarnated on Earth, Only to Get Summoned Back to My Old World
I got Summoned as a Saint with My Own Cheat System.
I Got Transported To Dota World with Just 2 shared Tanggos and qualing blade?
I got trapped in a dungeon brick
I got trapped in a dungeon brick.
I Graduated to become an Ant Queen (Isekai)
I Graduated to Become an... Ant Queen?! (Isekai)
I Guess I'm An Angel Now
I hate being wed in a fantasy world!
I Hate Systems
I Hate You Master
I have a Cat Problem (RWBY Comedy)
I Have A Dagger
I Have Infinite Skill Points in the Apocalypse
I have nothing
I have reach boundless infinity as a good for nothing. Now I want to restart in another world being the ultimate genius.
I have the Unique class of "Monster Factory"?[ DROPPED]
I Have to Text my Ex, or the World Explodes
I Help My Friend Get Together with the Girl I Used to Like
i Hunt Mansters?
I Just Fell Asleep and Somehow I'm on The Battleship?
I just had a realisation recently that I am surrounded by bishies and...
I Just Want A Break From This Stupid Tower
I Just Want To Eat 3 Meals a Day
I Just Want to Live a Peaceful Life!
I just want to live, so I will!!!
I just want to play alone!
I Just Wanted To Die But Instead I Became Immortal
I just wanted to fly
I Killed Myself but Woke Up in Another World
I Know I like Ships but Why did I reincarnate as a Aircraft Carrier?
I Live a Funny Life
I live in the dark world
I Live To Play VR-MMORPG
I Lived as a Growing Great Sage with my Fairy Harem in the New World
I love this world (Complete)
I love you but I'm a boy!
I Love You Like An Alcoholic
I Loved You
I Made One Mistake! Now I Have To Become the Demon Lord in Another World, But I'm Just a Frail Vampire Girl?!
I maxed out my Stats, so why am I still a loser?
I May Or May Not Have Caused the Apocalypse...? Tee hee~
I might be Overpowered
I Must Find Light, Or I Will F-ing Die!
I Need Healing!
I need money to level up!
I Need Time
I need to get off this rock!
I need to repair the gods of a world?!
I never asked for this life
I never asked to be in a rogue-like!
I No Longer (Make My Parents Proud)
I once was named Nguyen
I only know Curse Magic!
I only tried to change my childhood friend's gender!
I only want an ordinary life
I Only Wish I Had a Cliché Adventure
I reached Godhood by mistake
I Reached Reincarnation Limbo Too Early
I Read Too Many Light Novels
I Really Am An Internet Celebrity!
I Refuse To be A Character In A Novel
I reincarnated as a baby dragon king!
I Reincarnated as a God Working in a Shitty Sweepstakes Call Center
I Reincarnated as a Hero's Bad End
I reincarnated as a Hive Mind Slime
I Reincarnated as A Little Girl?!
I Reincarnated as a Panda
I Reincarnated As A System?!
I Reincarnated as an Alien Monster
I Reincarnated as an Elf in a Broken World.
I reincarnated as an octopus - There has to be a mistake
I Reincarnated as the Queen, Now What?
I Reincarnated As The Universe
I Reincarnated in Another World as a Vampire
I Reincarnated in Another World as a Woman's .
I reincarnated into a bat (Indefinite hiatus)
I Reincarnated Into a Fictional Character
I reincarnated into a Game called Liberty of Immortals
I reincarnated into an op villainess!?
I reincarnated... As a human!
I reluctantly became the dungeon master
I see Kai
I Shall Be Hero No More!
I Shall Build an Army
I Shall Eat Everything
I Shall Prevail
I shall seek revenge
I Shall Stand Supreme
I Shall Tame the World!
I should have been the Hero instead
I Slipped into Another World and Became this Demonic Guy's Pet
I Smell a Rat
I somehow became a being that spams to survive unprecedented circumstances
I sort of brought Armageddon, but on the bright side, I can go to school!
I study magic, for destruction?
I Suck At Reincarnations
I Summon Ballistics
I Summoned You
I Survived and Came Back to Apocalyptic Earth
I Swear my Brother's the Protagonist of a BL Manga
I Think I Got Stuck In My Favourite RPG :TFALM
I think i lost my head
I Think My Familiar is a DemonLord
I thought I was right
I Totally Don't Have Anger Problems!
I Tripped Over Satan
I turned into a little girl after I died?
I Unlive and Breath Death
I Value Your Clothes More Than Your Life
I wanna be a gamer!
I wanna be a hero! Beginning of the dark fantasy-
I Want a Dragon Waifu!
I Want It All - CHANGE!
I Want to Be an Adventurer to Defeat the Demon Lord but my Party Members Want to Live a Pampered Life!
I Want to Be an Adventurer to Defeat the Demon Lord but my Party Members Want to Live a Pampered Life!(Old)
I Want To Becoming A Great Summoner
I Want To Die, Let's Isekai!
I want to live
I Want To Live and Enjoy Life!
I want to play this deadly game again.
I want to restart my world but still have my knowledge and a few cheats
I Want to Save the World, but the Goddess tells me to Text my Ex
I Want You to Remember Me
I Wanted to Play a Strategy Game, But I Became King Instead!
I Was a God Until I Got Summoned
I Was a Loner, but My Class Got Summoned to Another World and Now…
I Was a Teenage Necromancer
I was an only child, so I asked God to give me many little sisters when I was reborn
I was Bored So I Became The Antagonist In a VR Game
I Was Born For Glory
I was born the Unloved Twin
I was brought in another world as my catgirl avatar.
I Was Given A Second Chance, In a World of Fantasy?!
I Was Hit By a Truck and Died, but Ended Up Getting the Blessing of a Goddess and Now I am a Trash Healer
I was invited here
I was just a rat living in the demon lord's basement
I Was Monster Once, Now I Am Human
I was Once the Demon King!
I Was Randomly Thrown Into A Game Like World By A Stray Astroid
I was reborn as a "Magical"Fairy which can't use magic!?
I was Reborn as a Background Character
I was reborn as a Cursed Swordman ?! [HIATUS]
I was reborn as a demon lord in another world but my morals contradict my title
I was reborn as a hybrid dinosaur in Another World
I was Reborn as the Villainess but I will become a Great Sage
I was reborn in another world with a maxed out speech skill
I was reborn into a fantasy world as a magic robot?! Automata Prime
I Was Reborn Just To Be Killed?
I was reincarnated as a dungeon, that's good, but where are my cheats?!
I was reincarnated as a fox in a strange world
I was reincarnated as a goblins' slave, became the hero, and now have a harem. "I'm a girl bye the way!"
I was reincarnated as a Magic Academy!
I was reincarnated as a monster flower
I Was Reincarnated as a Prince, but my Kingdom is in Danger from Enemies!
I was Reincarnated as a Puddle of Water
I was Reincarnated as Bai
I Was Reincarnated as Someone's Mana??
I was reincarnated into a fantasy world as a woman?!
I Was Reincarnated Into A Harem Game As A Villain, Please Stay Away I'm Gay! V1
I Was Reincarnated Into Another World As A Fish
I was reincarnated into my own unfinished Isekai Light Novel and became apart of the hero's harem.
I was reincarnated on the One piece World
I was Scum, now I am even more than Scum
I was summoned as a Dragon?!
I was Summoned as a Hero, but I Became the Demon Lord Instead
I was summoned in another world
I was summoned to another world without any cheats so I became a villager
I was summoned to another world, but i'm a dog!
I Was Summoned To Have Tea With The Demon Lord, But Now That I'm Stuck In This Other World, I Guess I'll Defeat Him
I was the pet rabbit of a young druid girl in my next life
I Was Transported To A Desert Wasteland
I who have Fallen
I will absolutely cultivate
I Will Always Be With You
I Will Be Everyone
I Will Be Recognized
I Will Be The Harem King!
I Will Burn Up My Kingdom And Disappear
I will create a kemono paradise!
I Will Kill My Way To Heaven: A Monster Evo Litrpg
I will Kill the Hero! With Fluff!
I will not be eaten
I Will Pave My Path With Blood
I Win So They May Hear My Voice.
I Woke Up As A Girl?!
I woke up as a mob from a harem anime one day.
I won't destroy the world!
I Won't Kill Myself for the Second Time
I Would be Your Legs
I'am not a hero: My adventure in another world
I'd Give You Mine
I'll be happy as a monster
I'll become a villain in my next life
I'll become a villain in my next life part
I'll do my best to (not)serve you!
I'll Kill the Whole World for Them
I'll Pay2Win in Another World!
I'll try this cultivation thing
I'll Wait For You At The Train Station
I'm (Sort of) an Expert on Ghosts
I'm a 70 years old mage not a little girl
I'm a Bat?
I'm a Bug in a Fantasy World
I'm a Cheater, So What?
I'M A Crazy Person Who Jumped In Front Of A Truck To Be Reincarnated Into Another World -On Purpose!
I'm A Demon Summoner, Damn It!
I'm a girl, but I like another girl?!
I'm a God?
I'm a Harpy Now I Guess
I'm a hero? Nope, familiar
I'm a Kitsune?
I'm a Man!
I'm A Monster, A Harpy
I'm A Professional Gamer, So How Did I Become King?
I'm A Sentinel
I'm A Snaaake
I'm a Stingray? (system novel)
I'm A Superhero
I'm a trash-tier villain in a fantasy dating sim
I'm a Vampire
I'm a Vampire [ Hiatus ]
I'm a wolf but I can level up?
I'm a wolf but I can level up? (Discontinued )
I'm a zombie
I'M Alive!
I'm Always Talking to Myself
I'm an Alley Cat with a Status Screen
I'm an Alleycat with a Status Screen
I'm basically a slave with a far too nice master
I'm clueless in another world.
I'm going to do it! I'm going to reincarnate into a fantasy world and live a great life!
I'm Gonna Be A Hero!
I'm Gonna Be a Wizard When I Grow up Again!
I'm Guilty, My Beauty
I'm immortal but my girlfriend is OP
I'm in a different world....but I don't mind
I'm in a Monster Girl World (MGW)
I'm JUST a Farmer NOT an Adventuerer! (Isekai) Light Novel (Watashi wa tada no nōmindeari, bōken-kade wa arimasen!)
I'm JUST a Farmer NOT an Adventuerer!!! (Isekai) Light Novel
I'm Just A Human
I'm just a mortal
I'm Just a Nameless Side Character in a Vampire Romance Novel
I'm Just A Summoner
I'm just an 'Ordinary' Human (MCU fanfic)
I'm Just the Guard!
I'm No Hero
I'm Not A Monster, It's Only A Mask
I'm Not a Tank
I'm not evil, trust
I'm Not Going To Let You Capture Me!
I'm Not the Demon Princess!
I'm Not The Dragon's Mom
I'm not the main character.
I'm Not The Protagonist?
I'm nothing special, so can i go back please ?
I'm on TDY from Hell
I'm overpowered
I'm Overpowered but I'll Let the Hero Do His Thing While I Save the Last Boss
I'm pretending to be a girl in a MMORPG
I'm Probably The Main Character Right???
I'm Raising A Chuunibyou Dragon Girl?!
I'm reborn as Sakura... well f*ck my life!
I'm reincarnated as the last god?!
I'm Reincarnated in Another World but God is an Anime Addict?!?
I'm Sorry
I'm Still Human
I'M Supposed To Be The Hero, So Why Am I A Skeleton!?
I'm Sure It'll be Fine! ...right?
I'm the bad guy!?
I'm the descendant of the Demon Lord!
I'm Too Tired of Being OP, So I've Decided to Lives Carefree Lives Instead[BL]
I'm... Skeleton A?!
I'Minas
I've Been Summoned as a Hero ...I'm a God Though
I've Reincarnated in another world as a cute fairy
I've reincarnated, but I'm a Girl! Wait, am I not even Human?
I've Transmigrated... with a Broken System
I've waited my whole life for this THE Apocalypse /On hold/
I, a Water Snail, accompanying the Immortal Hero
I, the CEO have to Farm to Survive?
I, The Lightning
I, The Maou
I, the son of Bloody Mary, have become a king of 6 realms.
I-Laxa:The Beginning
I. Galactic War
I.C.O.Y (Bxb)
I.D. Tech
I.R.O.N
I.S.E.K.A.I. Squad
I:DI/OM - Motherboard
I:Dragon
Iadral Online: The Final Frontier
Ice Cubes
Ice Queen By Wi1dBi11
Ice Queen in Another World - Volume 1
Ice Soulist
Icebound Immortal
Icy Vendetta
Idea Dump
Idealism
Ideascape
Ideascape: An Adventure LitRPG
Ideasthesia
Identity of the Abyss
Identity Undefined
Idle Dreamer: First World
Idle Immortal
Idmon the Skeleton
Idol By Laulau20
Idol's Road
If a Tree Cultivates in a forest and no one is around to stop it, does it make for a good story?
If all hope was lost, would you help me?
If i had emotions, would the world seem more beautiful?
If I Have To Be A Dungeon In Another World, I'll At Least Try To Be Fun
If I was going to Reincarnate why could I not have reincarnated as a Dungeon
If I win, will they hear me?
If only common sense was a bit more common...
If only...
If this Harem Manga Ends, I'll Die!
If We Cannot Grow Old Together
If You Give a Mouse a Dungeon
Iferes: Slaves Of The Gods
IGNARIS RAY by swey
Ignis
Ignite (The Fireborn Chronicles Book 1)
Igniter, Book 1: Bag Boy
Igniting Sparks
Ignition
Ignius
Ilhen's Seventh Deathtrap
Ilhen's Seventh Deathtrap — A Fantasy Adventure Tale
Ilhen's Seventh Deathtrap — A Fantasy Mystery Adventure
Illicit
Illuminated Azure Dragon
Illusion
Illusion/Core
Illusory
Ilm.Proxy Isekai
Im a Divine Flesh Golem?
Im a Kobold, So what
Im Going To Another World Even Though Im Not Asian
Im in an otome game i know nothing about
Imaginary World (The half world chronicles)
Imagination Is Creation
Imaginator
Imagine Dragons
Imagining Online: The game
Imaginings
ImBalence
Immense Space
Immersion
Immersion: Reboot
Immoral Cultivator Trump: The Alternative Facts
Immortal
Immortal Adventure
Immortal Anarchy
Immortal Apocalypse Marketplace
Immortal Ascension Tower
Immortal Ascension Tower (OLD)
Immortal Chronicles: Quest For Truth
Immortal Conqueror
Immortal Cultivator System
Immortal Demigods
Immortal Demon
Immortal Dual Sword God
Immortal Dynasty (Rewrite)
Immortal God of the Blade
Immortal in a Mysterious World(Cancelled)
Immortal in Another World
Immortal Ki Technique
Immortal Killer
Immortal Mage
Immortal Martial God
Immortal Necromancer
Immortal on Earth
Immortal on Earth (Dropped, sorry)
Immortal Path
Immortal Realm
Immortal Rebirth
Immortal Rising
Immortal Shards(hiatus)
Immortal Soul
Immortal Souls
Immortal Sovereign (Cancelled)
Immortal Stranger
Immortal sword
Immortal Swordslinger
Immortal Twain Dance
Immortal Tyrant in Another World
Immortal War
Immortal World
Immortal's Lament [Dropped]
Immortal's Life
Immortal's Musings: A Werewolf's Tale
Immortalis
Immortality.Upload (LitRPG: Athanasia - Book 1)
Immortals: The Curse of Samsara
Immortel Evolver Dungeon
Immovable Mage
Immutable
Imoogi
IMP-ressively Indecisive
Impact Origins Book 1
Impera
Imperator of Beasts
Imperator Of Chronos
Impersonator
Imphorian Prowess
Impossible Devices
Impostor
Imppossible
Impractical Magic
Improper force
IMProvised combat
Impulse
Impulsive - Descendants of the Gifted
Impulsive: Descendants of the Gifted
In a different world with the Seven Deadly Sins system
In A Different World, But With Friends
In a diffirent world with One Piece system. cliche? No it's a cancer cliche
In A Distant Past
In a medieval world,Why i got a malus instead of a cheat?
In a modern world with a game system!!!
In a new world, so lets go it alone!
In A Parallel World With Random Skills, I Reluctantly Become A Mafia Boss?
In a World Full Of Entities
In a World of Magic
In a World Without Coffee
In A Wuxia World
In another world as a homunculus.
In another world as a sim
In another world as my alt account character
In another world as my waifu #1: Brave New World and the Fallen Prince(ss)
In Another World as the Endling Demon
In Another World With a God
In Another World with Doraemon's 4D Pocket
In Another World with my Daughter
In Another World With My House
In Association with Death
In between lives
In Between Worlds
In dc universe with game system
In Harry Potter with OTS System
In Heart and Mind
In Highschool DxD With My Waifus
In Life and In Death
In Loki's Honor
In Loki's Honor (Rough Draft)
In Loki's Honor (season II)
In Love with Lightning
In Maple Halls
In Maple Halls, where Dwarves and Wizards Rest
In Memoriam
In My Name
In my Name as--
In New Dimensions Everyday
In order to create the Ultimate MC, I became Soldier A!?
In Our Image
In Our Last Moments
In Pursuit of Glory
In pursuit of greatness
In Range
In Search of a Protagonist
In Spite of it All
In That Moment of Suffering
In the Aether
In the Another World with a Young Body
In The Beginning
In the City of Wisteria
In The Dragon Ball Universe With The Summoning System
In The Dragon Ball World with a System
In The End
In the End the Truth Remains
In the eyes of Infinity
In the Eyes of Others
In the House of a Witch
In The Light Of Fire
In the MInd of an NPC
In the modern world with a game system!!! Reworking!!!
In the name of blood
In the Name of God
In The Name Of Hope: To Become A God
In the Name of the Unholy Spirit
In the Naruto world (1)
In the Shadow of Heaven
In the Shadow of the Builders
In the shadows
In the Sorcerer's Service
In The Spiral: Connected Stories and Fragments from the Virtual Future
In The Tall Grass
In the Temple of Glass
In The Tyrant's Embrace
In the Wake
In this Dangerous World
In This Supernatural World Of Mine
In This World
In Umbra Hasta
In-game Item Storekeeper
Inada
Inalienable Rights: The After-Hours Molar Message
Inalienable Rights: The Azodii Necktie Negotiation
Inalienable Rights: The Notorious Necktie Negotiation
Inara
Incandescents
Incanto Anima
Incarnation
Incarnation : Another Dimension
Incarnation of Ice and Fire
Incarnation Of The One
Inception of Cultivation
Incomparable - (Unparalleled)
Incompatible Universe Merge
Incompetent Second Son
Incomplete
Incrementum
Incubus
Incursions
Indebted
Indebted: A Human/Robot Romance
Indefinite
Indigo
Indisposable Trash
Indistinct Instinct
Individuality Book 1 - The Burning Rose
Indomitable Marvel
Industrialising Dungeon: The Crimson Forges
Inertia
Inexorable Chaos
Infamous
INFAMOUS: Heroes of Villainy
Infarite
Infected Life {ON HOLD}
Infernal Bones: Book 2 in the Elemental Dungeon Series
Infernal Gems: Diamond
Inferno
Inferno of Ice
Infestation
Infested
Infigeas Online
Infinite energy in the distortion world
Infinite Frontier
Infinite Gameplay
Infinite Hiatus
Infinite Hiatus (completed)
Infinite Horizon
Infinite Horizons
Infinite Legend
Infinite Levels
Infinite Lifetimes
Infinite Martial Way
Infinite Monarch of the Divine Path of the Six Forms of Steel
Infinite Possibility
Infinite Quest: The Crazy Ice Wizard
Infinite Realm: Monsters & Legends
Infinite Realms (Working title)
Infinite Swordsman and His Cafe
Infinite Thera
Infinite Trigger: Wandering Soul
Infinite Wishes
Infinite: Monster
Infinity
Infinity - Aria's Odyssey
Infinity Arcana
Infinity Hero
Infinity Loop
Infinity Online
Infinity Start
Infinity Summoner ~ Summoner Of All
Infinity Tomes - Legacy of the Ancients
Infinity/10
Info on Andar's Worlds
Info on {The Sphere}
Infracto Animo
Ingame
Ingame 2 Homeland
Inglorious Bastard
Inhappening
Inheritance
Inheritance Of A Hobo
Inheritor of the two dragons
Inheritors
Inheritors (DEFUNCT)
Inheritors of Eschaton
Inhuman
Initializing the Code System
Ink Serpent
Ink Stained Eyes
Inked & Pierced (LGBT)
Inkway to Albreton
Inner Light
Inner-Self
Innocence
Innocence: Exiled Prince
Innocent Devil's Harem
Inquilbus
Inquilbus **Indefinite Hiatus**
Inquisitor
Inquisitor [HIATUS]
Inquity Blaze
Insane Familiars And How To Deal With Them in Game and Real Life
INSANE: Humans and Demons
Insanely Lucky
Insania Online
Insanity Online! The Forging of A TRUE NORD
Insanity Paradox
Insatiable hunger
Insect Dungeon Vs The World
Insect Dungeon vs The World. (On Hiatus!)
Insectasaur
Insectum Chronica
Insert Coin To Continue
Inside Metsys
Inside my Mind
Inside Us All are Seraphs
Insignia
Insignia's Story
Insomnia's Embrace
Inspector of God
Instant Practice
Instant Supreme God
Instinct
Instinct Unlimited
Instruments of Fate
Insurmountable
Insurmountable(Hiatus until Summer)
Integration
Integrity and Solace: Divine Intervention
Intellectum [RealRPG series] Book 1
Intellectum [RPG Apocalypse: Book 2]
Inter Caelum et Terram
Inter-dimensional House Travel
Interactive Dungeon
Interactive Evolution
Interactive tribe
Intercessor
Interdimensional Garbage Merchant
Interdimensional Traveler
Intergalactic Convicts
Interlude
Interstellar raiders: A collection of short stories
Interstellar Warlock
Interstellar Warlock 1: Emancipation
Interstellar World Struggle TV
Intertwined World Domination!
Intertwined: Summoned to Another World
Intervention
Interverse
Interview With the Hattoris
Interweaved Destiny
Interworld
Interworld Network: The Time Master by Dmitry Bilik
Into a Fantasy
Into a Strange World
Into Nothing
Into the Abyss
Into the Black
Into the Everwood
Into the Hulk
Into the Inferno
Into The Light
Into the Maelstrom
Into the one-piece world
Into The Portal: Monster Invasion
Into the Portal: The Expedition in Centauri Planet
Into the rainforest
Into the Rift: Akali
Into the Secret (name still needed)
Into the Secret of Tirlus
Into the Storm
Into the Sun
Into the Trenches
Into The Valley Of Gods
Into the void
Into The Wasteland
Into the world of Hero Academy
Into What Is Impossible [Special Forces In Another World]
Intrepid
Intricate Soul
Intrinsics
Invader Zim >> Not Just a Defect <<
Invasion
Invasion - A Nanomachine Magical World LitRPG Adventure
Invasion by Fire and Thunder
Invasion of the Dust Mice
Invent, Transform, Create and Destroy
Inverse Summoning
Inverted (Isekai)
Inverted: A Dark Isekai Fantasy Novel
Invictus
Invictus: Memoirs of an otherworlder on a mission
Invijible Panda
Invincible
Invincible all eons
Invincible Canadian Futa Goddess Cultivator
Invincible Canadian Hermaphrodite Goddess Cultivator
Invincible Canadian Hermaphrodite Goddess Cultivator.
Invincible Canadian Hermaphrodite Goddess Cultivator: Redux.
Invincible in other world
Invincible War God
Invincible wizard at Fairy Tail
InVirs
Invisible Werewolf Dracula meets Vampire Mummy Frankenstein
Invoker
Iona Online
IQ 100+ Samoyed
Ira's Faithful
Iraslyn
Iris
Iris (Hiatus)
Iris (On Hiatus: Exams)
Irminsul - [participant in the Royal Road Writathon challenge]
Irobu's Odyssey of Deceit
IROKO - A NextGen Naruto Fanfiction
Iron Blood Overdrive (Hiatus)
Iron Engine
Iron Saga - A Military science fiction adventure
Ironclad
Ironclad: Another world conquest
Ironclad: Another world conquest with unbeatable technology
Irrationality
Irregular
Irregular (Rewritten)
Irregular Awakening
Irregular Elementalist
Irregular Entity
Irregular Leveling
Irregular's Rebellion
Irresponsible Former God of War Renox
Iruedim
Iruedim (Children of the Volanter)
Is Heaven Supposed To Be Like This?! -Mature
Is it Possible to Kill a Hero?
Is it Really Ok for a Dungeon Master to Manage a Dungeon?
Is It Really That Hard To Become A God
Is it Reincarnation if I'm Still Dead?
Is It Too Late To Move My Lair?
Is It Wrong For A Spiritron Hacker To Pick Up Girls In A Dungeon?
Is It Wrong To Be A Mutant?
Is It Wrong to be a Vampire in a Dungeon?
Is It Wrong To Be Summoned Into Another World?- A Danmachi Fanfiction
Is It Wrong to Try to Pick Up Girls When You're Disguising as a Girl?
Is that a T-Rex outside my cave?
Is that a T-Rex outside my cave? (On Hiatus)
Is That A Wisp?
Is This Really Another World?
Is this really luck?
Is This The End?
Is your Mama and Llama
Isekai - If I was Born in Another World
Isekai Assassin
Isekai Avenger
Isekai Battle Royale
Isekai Delivery Service
Isekai Dudes On The Run
Isekai Dungeoncrawl - Am Ende mit meinem Latein
Isekai Dungeoncrawl II - The Sea-Godess weeps for Lemuria
Isekai Explorer
Isekai Gundam
Isekai Gundam (Dropped)
Isekai Gundam (Reboot)
Isekai kami desu ka? -- (God of another world is it?)
Isekai Mafia: Founding a Crime Organization in Another World
Isekai Mafia: Founding a Criminal Organization in Another World
Isekai Magus (A LITRPG Light Novel)
Isekai Magus (A LITRPG Progression Saga)
Isekai Mother
Isekai Reporter
Isekai series: Peaceful daily life of Orphanage manager
Isekai Speedrun
Isekai Strategy Game
Isekai Survival
Isekai Tales
Isekai Toaster - Toasting Bread in Another World
Isekai trash story
Isekai Warfare
Isekai Winner: Super Sweepstakes!
Isekai Zombie
Isekai'd as a Level 999 God King but my Fate was changed to a Shadow Girl???
Isekai'd slave
Ishbula-na' (I've joined the family of the lord of the 7th ring of the Abyss, help!)
Ishtar, the overabundantly fertile goddess
Island
Island Of Gods
Isolated Dungeon: Breaking The Chains Of Fate
Isolated Together
Issekai Mockery
It seems I reincarnated into that world, time to avoid the death flags!
It Spreads
It Started with Slime
It Starts With Chapter One
It That Laments
It Was All Just A Mask [A Dramione Story]
It wasn't my fate
It will end badly
It's a Gamers world after all!
It's a Reincarnation of the Reincarnator
It's a Reincarnation of the Reincarnator (Book I)
It's An Isekai Story, I Think?
It's cause I'm a genius
It's hard being the fourth wheel in a love triangle
It's not a game
It'S Not About Destiny
It's Not Easy Making Money in the Apocalypse
It's not Paranoia if you're Right!; A Talltale of Nervous Wreck become a Duke in Other World
It's Only Another End of the World
It's raining goblins !? [Dropped]
It's the Healer's Life for Me
It's the Healslut's Life for Me
Itas Adventure
Iterum Nata
Ithaca
Ithalon: Galaxy Wars
Ithalon: The Glass Cannon
Ithalon: The Weapon Spirit
Ithalon: The Xenos' Files
Ithavoll Saga
Ito Ai: A New Dawn
Its an apocalypse?
Its Not So Bad To Wake Up In A Goblin Dungeon
Itxaro
Ivan-The Terrible
Ivellee Ivelleh
Iverson's Pillar
Ivory Crystal
Izar
Izgaea Tales
Izumi Hayato with System
I´m the Dog of a young Mageknight
J`nk: Refuse Refuge
Jack
Jack 21
Jack and Diane
Jack at World of Syntaria
Jack Mercury: Battle Academy
Jack of All
Jack of the Devil's death forged body
Jack's Adventure
Jack's Journey
Jack's Unlikely Adventures
Jack, The Inter-Galactic Wizard
Jack-of-All-Mages
Jacob WillBreaker
Jade Fire
Jade Fire (Hiatus)
Jade Fire (Wuxia)
Jade General
Jade Immortal
Jadepunk
Jaeger Saga
Jaflov
Jager: The death Angel
Jake and the Dynamo
James Foremans Star Jump
James Hunter
James of Galendar
Jane Doe Chronicles - The Case of the missing Imaginary Friend
Jank
January City (Project Lunation Book 2)
Jasmine
Jaune, The Strong
Jayke Cipher
Jayson Agonistes: Breaking Hell !
JC's Future Works
Jellyfish
Jeremy's Guide on How to Survive a Zombie Apocalypse
Jethewel
Jewel Story
Jeweler
Jezoi
Jigoku 101 no dasshutsu hōhō.(How to escape hell 101)
Jiharu: A Story of The Hunt
Jim's World
Jimoel the Great and Powerful
Jin
Jin The Talentless
Jinsei no Hineri
Jinsei no Hogo
Jintetsu
Jirandai
Job Arseoth - A Choose Your own Adventure
Job Arseoth - A CYoA Adventure
Job Change
Jobless Knight
Jobs for an Occult Handyman
Joe & Jess: Life inside a PC Game
Joe in medieval fantasy world
Joe– the chimpanzee cultivator
Joh-El, a Kryptonian in the Marvel World.
John
John Doe: A Nobody in Space.
John Smith
John the Average Knight: Marvellously Mundane
Johnny's Bizarre Fidget Spinner
Joie de Vivre
JoJo na Kimyō na Bōken: New Dawn
Jojo's Bizarre Adventure: Kars' comeback
JoJo's Bizarre Adventure: Run the Jewels
Joker's Potpourri
Joker's way of life
Jokes On You
Jolly Cooperation
Jolt
Jona R. Torres and The Sea Empire of Navarren
Jonah Now Jasper
Jordan Leoren – A Tale From The Wizarding World
Jormugandr's calamity
Jormungandr's calamity
Joruney To The Starry Sky
Jotuun
Journal of a Falcon
Journal of poetry
Journal Teleport Science Something
Journals of Cultivation
Journey
Journey for Destiny: One Piece
Journey In A New World
Journey into My New Life
Journey of 365 Days
Journey of 365 Days (((Kind of Completed)))
Journey Of A Creator
Journey of a God [LitRPG]
Journey of a God [LitRPG] [Haitus]
Journey Of A Hawk
Journey of a Mage
Journey of a Scholar
Journey of a Skeleton (undergoing rewrite on different account)
Journey Of A Stoner
Journey Of Destruction
Journey of Key (Updated)
Journey of my Core
Journey of Robotics
Journey of the Black Rose
Journey of the cheerful assasin
Journey of the Mind
Journey of the New World
Journey of the Time Mage
Journey of the Unrivaled Mage
Journey Of The Unrivalled Mage
Journey of Worlds : Auto System
Journey Through the Realms
Journey Through the Underdark - Eric EarthScorn Book 1
Journey through the Worlds
Journey to Amoraketh
Journey to Boundless Infinity
Journey to Elvander
Journey to Power
Journey to Raise a Dodge-Debuff Scarecrow
Journey To The Hell's End
Journey to the Underdark - Eric EarthScorn Book 1
Journey West 5000
Journey: Kai Yuuki
Journey: Rayder White.
Journeying Home
Journeyman
Journeys in the Fairworld: The Brigand of Potham (Complete)
Journeys in the Fairworld: The Gatekeeper
Jovan's Gaze
Joyde's Yellow Book - Volume 2
Judah Judas Adventures
Judas Valiant: Chorus of the Machine Giants
Judging The Creation
Jumper
Jumpspark
June
Junkland
Junkyard Magician
Jupiter's Rising
Jurassic Island
Juryokine
Juryokine: Exile of Heroes
Just a Bystander
Just a Cannon Fodder
Just a Dream
Just a garbage fanfic
Just a garbage pokemon fanfic
Just a Guy in Space
Just a passing goddess, don't mind me.
Just a Pawn
Just a place to practise some edits, dont come here.
Just a random guy surviving Apocalypse litRPG
Just a random Zodiac Book in the Internet
Just a Rock
Just a Rock[DROPPED]
Just a Simple Guy
Just A Simple Heist
Just A Story
Just a Teacher
Just A VRMMO Story
Just a zombie trying to survive
Just an average man!
Just An Outlier
Just Another Dungeon
Just Another Gacha System In Another World
Just Another Isekai
Just Another Isekai Story
Just another random summoning story
Just another RPG story
Just Another Story After End
Just Bear it
Just Because Goblins are Level 1 Mobs, Doesn't Mean I Can't Explore the World!
Just Call me Yumi
Just Deserts
Just Don't Shoot the Quartermaster
Just For Fun
Just let me be a cannon fodder
Just Luck
Just one more level
Just Practicing
Just Practicing, Nothing To See Here
Just Useless Ideas for a Novel
Just your typical isekai story, or is it?
Just your usual summoning story
Justice in the One Piece World
Juvena
Juvenile Gladiators
K. O. Romance [ノ ッ ク ア ウ ト ロ マ ン ス]
K.I.N.G.
K.I.X
K.O.D. by Lirg123
Kael - Rise of the Blood Mage
Kael Cor:A Vampire's Awakening
Kaels Adventure
Kage in another world
Kage no Kami
Kage System
Kaiba's Prostitute
Kail's Life of Adventure [dropped]
Kain's Adventures
Kain, the Caveman
Kairos
Kairos & the Snowdrifts
Kairos & the Snowdrifts (Edited)
Kairos: A Greek Myth LitRPG
Kaiser de Jinrui
Kaiser Jager The Mutagen Hunter
Kal Blade
Kalar's continent
Kaleidoscope
Kaleidoscope Book 1: Night has Fallen
Kaleidoscope Book 2: Moon Has Fallen
Kaleidoscope End
Kalestra's Chosen **On Hiatus**
Kalethia
Kali Yuga
Kallix Rane
Kalon
Kalos
Kalui
Kammi Kettu
Kana & Wing: Adventure Time on RoyalRoad
Kana Adventure
Kana death god
Kana the Killer
Kanai's Alchemical Rock
Kano's Necromantic Comedy
Kanojo no Jin
Kara City Chronicles
Karacatoa - Descent into Madness
Kariya Matou's Amalgam System
Karl
Karl Became an Axolotl and now he's in a Cave
Karma
Karma - The Game
Karma and Reincarnation
Karma Online: Awakening
Karma's curse; the demon lord of wrath
Karmic System
Karn
Katalepsis
Katarina the Witch Hunter
Katarina the Witch Hunter Book 1: Forest
Katarina The Witch Hunter Book 2: Aston
Katarina the Witch Hunter Book 3: Norn
Katarina the Witch Hunter Book 4: Ardeal Ordeal
Katarina the Witch Hunter Book 5: Darnell
Katarina the Witch Hunter Book 6: Fragments of Memory
Katarina the Witch Hunter Book 7: The Trial
Katarina the Witch Hunter Book 8: Sasaki the Witch Hunter
Katarina the Witch Hunter Book 9: The Saint
Katarina the Witch Hunter: The Complete Collection
Katra
Kay=Zero
Kaylee's Journey
Kaz the infinite one
Kazama wa Onnaline
Kazan - The Hero No One Wanted
Kazuri
Keep Breathing
Keep it a Secret
Keeper
Keeper of Steeds
Keeper's World
Keepers of the Neeft
Keepers of Truth
Keeping it together
Keeping The Balance
Keflar - A Tale of an Unusual
Kelly
Kelras Chronicles, Book one - Striving for the stars
Kenosis of the Light Bearer
Kernstalion
Keter
Kether(Discontinued)
Key To Abusing The System
Key to another world
Key to the Void
Keybash! GAME JAM!
Keys of the Endpoint
Khiral (A LitRPG Dungeon Adventure)
Kibo: The New Age of Cornith
Kichiro's Rampage
Kill 10 Rats
Kill Anna!
Kill the Caster
Kill the Joker: Survival Game
Kill Thy Gods!
KillDozer
Killed by a Japanese girl who fell crotch first on my face
Killed, Blessed, Reborn
Killing Amount
Killing Game
Killing Tree
Killing X Intent
Killing Zombies Is Like A Game?!
Killstealer
KillStreak
Kind's Kiss
Kinda Dead: The Infernal Escapee
Kinda Real Online
Kindergarten goes LITRPG
Kindling Stars
Kindling Stars [Hiatus]
Kindred
Kindred Spirits
Kinetics
King
King - Hiatus
King Above All Others
King Cipher
King Eden Volume I
King Elementalist
King given from God
King Merc
King Of All Heavens
King of Another World
King Of Ant
King of Apocalypse
King of Beasts
King Of Beasts (On Hiatus)
King of Cards - Superhero Litrpg
King of Glass
King of Hell
King of HOLLYWOOD (Revised)
King of Kings
King of Nobody
King of Ohst
King of Rogaria
King of Ruin
King Of Solace
King Of The Broken World
King of the Djinn Kingdom
King of the Fall: Origins
King Of The Farm
King of the Mountain
King of the Mountain, Again
King of the Multiverse
King of Woe
King Slime:From an Experiment to A Ruler, Backstory of a Boss
King system
King's Anarchy
King's Game : Zixx (The Monster)
King's Genesis
King's Throne: Snow's Story
Kingdom
Kingdom Come
Kingdom Come: Archemi Online Chronicles Vol.3
Kingdom Creation System
Kingdom of Bees
Kingdom of death
Kingdom Of Demons
Kingdom of Earthos
Kingdom of Earthos (Book 1): The rise of an Eagle Rider.
Kingdom of Heartedvast
Kingdom of Ice
Kingdom of Mallic
Kingdom of Monsters: La Guardia
Kingdom of Ohst
Kingdom of Stars
Kingdom of the Dead
Kingdom of The GhostShepard
Kingdom of the Lich
Kingdom of the void
Kingdom of Tyr (Original)
Kingdom Quest
KINGDOM RISE, CASTING CROWNS: Your Way Called Peace
KINGDOM RISE, CASTING CROWNS: Your Way Called Peace (ACT I)
Kingdom Saga
Kingdom Shattered
Kingdom: To Rebuild the Lost
Kingdoms of Blood, Magic, and Apocalipse
Kingdoms Online
Kingdoms: The Game of Feuds and Feudalism
Kingmaker
Kings
Kings (Volume 1)
Kings Game : The Origin Of A Monster
Kings Game : The Origin Of A Monster (Rewrite)
Kings Rising
Kings Rite
Kings: Immortals Amongst Us
Kings: The Fall
Kingun
Kira's second life
Kirby System
Kiri to Shinkirō | Mist and Mirage
Kisama No Ketsugo
Kismet - Volume 1 - A Song Written from Ash
Kismet Online: Root Alpha
Kiss of Tragedy
Kitsune
Kitsune in Rockford
KITTY KITTY - The future that never was
Kiturasha God
Kiwi Hunter
Kiyu's Box
Klaxon Overdrive Supernova
Klaxon Overdrive Superrnova
Knight & Condemned
Knight & Condemned (Completed)
Knight & Condemned (Completed)
Knight and Deserter
Knight and Smith
Knight City Nights
Knight Endeavor: The Crimson war
Knight Hunter
Knight of Corruption: The Seventh Swordsman
Knight of the Rising Sun
Knight of the Rising Sun Volume 1: The boy with the katana
Knight X Magic
Knight's Crusade: Regulus War
Knighted
Knightquest, Or The Tales Of A Lonely Knight: Interactive Gamelit/Litrpg
Knightquest: Interactive Gamelit/Litrpg
Knights Of The 6
Knights of the Faux God
Knights of the New Queen: Protector
Knights under a Green Sky.
Know Thy Enemy
Knowledge and Power
Known Danger System 42
Koala Online
Kobold
Kobold Expansion
Kobold Whisperer
Koins for Karon
KOJI FIGHTS THE WORLD! (The Bonder Legacy Book One)
Kolver
Kommentárok
Kool Kobold
Korrupted Angels
Kosmos
Kova + Rey
Kreaturen
Kripp's Fate
Krsnik
Kudo's Magic Touch
Kueng Ning
Kuni no Senso
Kuni no Senso Volume 1: The Man from the Unkempt & Kunshu
Kunoichi Online
Kuro's Days
Kuromori-san's Table Tutorial!
Kurouzu 「クローズ」
KurtzPel:
Kusan The Death Lord
Kyle
Kyrio's Monster House
Kyrio's Monster House (Dropped)
L
L'Enfer et le Lapin
L.I.F.E. Begins
L.I.F.E. Begins (Book 1 - Complete)
L.I.F.E. Stories
La Familia mas poderosa del mundo de Harry Potter
La Fantoma
La puerta de Maltras
La Puerta de Maltras eng.
Labyrinth of Anchored Moments
Labyrinth of Gods
Labyrinth of Light: Stormbringer
Labyrinth Of Puppets
Labyrinthia's Maze
Labyrinthium
Lachrymation: The Lord of The Unreachable Tower & The Child Walking The Bleak Path
Lackluster Adventure of a Side Character
Lacraea: The Slow Journey To riches
Lacuna: A Nexus Troupe Novel
Lads of the Triangles
Lady Bunny
Lady Sunshine and the Drowning Games
Lagoon
Laim And The Garden
Lainzax
Lair
Lake Chillmoore
Laksil
Lamb of Misfortune
Lambs and Wolves
Lament of The Demiurge
Lament of the Determined
Lament of the Fallen
Lament of the Slave
Lamp of Gods- Tales of an Immortal
Lamplight
Lancelot Deep Impact
Lancelot Dungeon
Lances & Daggers
Lances & Daggers
Lances and Daggers
Land of Astria
Land of Athlora
Land of Chi: The Legacy Trial
Land Of Dragons
Land of Erden
Land of Ilragorn
Land of Irith
Land of the Dead Sun
Land Of Zhelerez
Land Warrior: Greyhounds
Landasy Reality: Demon's Rebellion
LandFall's legacy
Landfill Life
Lanuleta University: A World of Magical Science and Strange Connections
Laria - A LitRPG
Laruse
Larystaro
Lasershark of The Laserocean
Last Born of Kiedarth
Last Dance
Last Dream
Last Embers: A Loki Story
Last Feast
Last flames of the Old World.
Last Flight of the Raven
Last Game
Last Goodbye
Last Grace: The Apex of Another World
Last Grace: To the Apex of Another World
Last Hope
Last Howl
Last Man On Earth When There Is No Earth?
Last Man Tournament: Altair
Last of the 300
Last of the Mage-Kings
Last Ramas
Last Shadows of a Booming Sky
Last Son
Last Stand
Last Voice in the Darkness Series, Book 1 - Survivor
Last wish from Dead past ( on work title)
Last Year [of High School]
Late Night at Lund's
Late to the game
Laurels and Thorns
Laus Deo
Lavender Rose
Law of Creation
Law of Divine Gates
Law of Incongruity
Law of Shadows
Law of the Forest
Law of the Jungle
Lawless
Lawless Ink
Lawless World
Laws of Defiance
Laws of Fate
Laws Raine
Layers of Hell
Lazarus: Jove's Tale
Lazy Ash
Lazy Cat
Lazy Cultivation
Lazy Detective
Lazy Dragon Queen: Gaming in an Illogical World
Lazy Guy With Dimensional Group Chat
Lazy Man's End of the World
Ldk
Leading marvel in The Right Direction
League of Meruem
League Of The Void
Leagues Away From The Sun's Light
Leah, Reincarnated As a Dungeon Core!
Learn to Evolve
Learning to be a Bad Guy
Leave A Scar (Fullmetal Alchemist)
Leaves of Terranthir
Leaving Earth
Left Behind In Another World
Left In Sorrow
Left Over Necromancer
Left the World as Villager A. Came Back a Mecha Pilot.
Left Unspoken (Book One of the Betrayal Series)
Legacy
Legacy (vrmmo game)
Legacy - Book 01
Legacy of Ancients
Legacy of Darkness: Book 1 - Darkness Ascendant
Legacy of Darkness: Book 1 - Darkness Rising
Legacy of Ennea
Legacy of Kail
Legacy of Power
Legacy of Terra
Legacy of Terra: Forgotten
Legacy of the Ancient
Legacy Of The Blade
Legacy of the Damned
Legacy of the Demon Lord
Legacy of the forgotten
Legacy of the Forgotten Continent
Legacy Of The Prototypes
Legacy of the Resourceful Hero
Legacy of the Sea
Legacy of the spirit king, Spirit Dungeon God edition (Currently being rewritten / revamped)
Legacy of the Swap
Legacy of U.L.T.R.A
Legacy of U.L.T.R.A (dropped)
Legacy of U.L.T.R.A (hiatus)
Legacy Of Weapons
Legacy Online
Legacy Unbroken
Legacy: God's Inheritance
Legacy: Lord Alba
Legend
Legend Land: Tale of the Nameless God
Legend of Aerolite
Legend of Amnesiac Archer
Legend of Chase Marcus
Legend of Darkness
Legend of Eterna
Legend of I, Reaos Alzerin
Legend Of Kaiser
Legend of Legendary Summons!
Legend of Lunos [Dropped]
Legend of Magus Academus 1: The Pillars of Unity
Legend of Mammon
Legend of Rall Gregory
Legend of the Black Blade
Legend Of The Blacksmith King {Hiatus}
Legend of the Conqueror by CyberBeast
Legend of the Crystal Borne: Wielders of Lightning
Legend of the Devourer of Kings
Legend of The Divine Beasts
Legend of the Dragonborn
Legend of the Empyrean Blacksmith
Legend of the Evil Hero
Legend of the Five Knights 1- Rise of A Guardian Angel
Legend of the Five Knights 2- The Shadow of Justice
Legend of the Forsaken One
Legend of the Guild: Point Blank
Legend of the Gunslinger Mage
Legend of the Heavenly Monarch System
Legend of the immortal robot
Legend of the Infinity Blades
Legend of the Lost Star
Legend of the Lost Star [Book 3: The Last and the Lost]
Legend of the Lost Star [Book 4: The Unravelling World]
Legend of The Matriarch
Legend of The Monster Slayer
Legend of the Nameless Hero
Legend of the Perfect Emperor
Legend of the Phantom Hero
Legend of the Sage by Daedalus
Legend of the Seven
Legend of the Sixth Sage
Legend of the summoner class
Legend of the Sword God
Legend of the Sword Immortal
Legend of the Undead Sovereign
Legend of the Void
Legend of the Void Lord
Legend of the Void Walker
Legend of the wasteland
Legend of Truck-san
Legend Of Unfathomable One
Legend of Yomi
Legend Tales: Fallen Hero
Legend to God Restart
Legend: The Rise Of The Black Phoenix
Legendarium
Legendarium Props
Legendary
Legendary Archers Series: Shattering Arrow
Legendary Archers Series: Shattering Arrow {Dropped}
Legendary Archers Series: Shattering Arrow {Long Hiatus}
Legendary Continent
Legendary Crafting System
Legendary Crafting System {Dropped}
Legendary Crafting System {Long Hiatus}
Legendary Dungeon Seed
Legendary Elemental Knight
Legendary Exile
Legendary Farmer
Legendary Puppeteer Master
Legendary Reincarnator
Legendary System
Legendary Twilight Farmer
Legendary Void Dungeon
Legendary Wife : Overpowered Songstress book 1
Legends
Legends of Adora, This Halfryta's Garden
Legends of Arenia: Arrival
Legends of Balance: Alaiah
Legends of Bitworld: A Misnomer's Tale
Legends of Dorthar: Kato's Tale
Legends of Etheria
Legends of Gods. Tale of Vjaira.
Legends of Lost Fallow: Age of Heroes
Legends of Pandorus I: Song of A Crimson Angel
Legends of Regalia book 1: Tyranny and Villainy
Legends of Tarthirious, A LitRPG, Book One of Kylia's Story
Legends of Tarthirious: Book Five of Kylia's Story
Legends of the 21st Century (Complete)
Legends of the 21st Century (dropped)
Legends of The Great Savanna - Complete Book 1, Ongoing Book 2
Legends of the Shadow Immortal
Legends of The War God
Legends of the Wesh: Lochley
Legends of The Worlds Gate
Legends Of Valkyries:Endless war on Middle Earth
Legends of Zyantra: Immortals
Legends Online
Legion
Legion, God of Monsters
Legionary (dropped)
Legionnaire
Lein Saviik
Lemme Smash! (Hiatus)
Lemondream
Lemongrass - A Cultivation Story
Lemongrass - The Chaotic Life of Meadow Song
Lemur Goes to Forash
Lens: Allegiance
LEo
Leo The Lion
Leonel's Workshop
Leonora
Les Cents Royaumes d'Aldire [French]
Les Kerns de l'Oubli - tome 1 : L'Exil [FR]
Lesser Evil
Lesser Evil - [participant in the Royal Road Writathon challenge]
Lesser Throne of Seventh Heaven
Let Me Make You a Star
Let the games of survival begin!
Let the hunt begin!
Let The World Burn in Ruins
Let there be fire
Let's Be Gods!
Let's Define Evil
Let's Explore The New World!
Let's Form a Party to Kill God
Let's Go Anywhere: The Journal of two Idiots
Let's Heal Our Wounds Together
Let's Invade A Fantasy World!
Let's play a game
Let's Shine
Lethal Virtue
Leticia
Lets live safe and happy life
Letter B Above Hell
Letters from a Dying World
Letters From a Lost Bird
Letters From Beyond
Letters: Naruto's Rebirth and Redemption
Letting Go...
Level 99 Looter: Among The Ancients
Level Down
Level One Chef
Level One Commoner
Level system vs Cultivation methods
Level Up
Level Up Hero!
Level Up Lord
Level up or Die: Masochist
Level Up!
Level: Zero
Leveling Immortal
Leveling up !
Leveling Up Is Better Than Reality
Leveling up the World
Lever Action
Levia Codex
Levis Magus
Levy's misfortunes
Lewd Dreams X Life Incomplete (Light Novel Coming Soon)
Lewd Slime Surpassing The Heavens With Yandere Waifu
Lewis
Lexson of Aerolite
Ley World-The Game
LFSA - Starting from the summoning
Li'Kyes the Scaled Hero [HIATUS]
Lia
Lia and Lara will seek the One Piece
Liar Liar
Liars Called
Liberi Fatali
Liberty in the Overlord Universe
Liberum Mundi
Library Magic
Library of Knowledge - A tale across worlds
Licentia - Child of the Abyss
Lich Diary
Lich Dungeon
Lich in Hero's Realm
Lich. The Depressed Necromancer
Lichen Leech
Lie
Lied
Life
Life - Break
LIFE - Root
Life and assumptions of Dread The Caveman
Life As A Dungeon Core
Life as a Game, Cool
Life as a mercenary (Inactive)
Life As a Servant
Life as a solo gamer
Life as an Alpha-Knight
Life as an Independent Space Hauler
Life as the World's Most Feared Monster!
Life Changing Status Screen
Life Hunter
Life in a changed world
Life in a Fantasy World
Life In A Galaxy Far, Far Away
Life in a Red World
Life in another world
Life in another world (On hold)
Life in another world with an Immunity System
Life In Doecroft
Life in New World (LNW)
Life in Newerth
Life In Purgatory
Life in Thar'al
Life in the dungeon
Life in the naruto world.
Life in the New World
Life in the North - An Apocalyptic LitRPG
Life Insignia - A Lit!TacticsRPG.
Life is a game, with intrusive microtransactions.
Life is Boring.
Life is but a Dream
Life Is But A Game
Life is Feudal
Life Is Just A Game
Life is Just_____
Life is not a game: Ice
Life is too short, let's murder to make it longer!
Life is Wilde
Life Isn't So Simple Anymore.
Life Leak
Life Magic, An Elemental Fantasy
Life Merchant
Life of a Core
Life of a gloomy boy
Life of a Grimoire
Life of a Hairpin
Life of a Immortal
Life of a world tree druid
Life of an Irregular
Life of an Undead
Life of an Unusual Troll
Life of David
Life of Elric
Life of Evil
Life of Numbers
Life of the dark god
Life Of The Vampire Girl
Life Of The Vampire Girl - [Dead]
Life on Jupiter Station
Life Reset
Life Restart: Team Deathmatch in Another World
Life Sentence
Life Spent
Life Story of the Silent Seven Swords
Life Sucks So Deal With It (LSSDI)
Life Symphony
Life With A Blue Screen
Life Without Memory
Life Without Time
LIfe's a game
Life's Blood
Life's Exodus
Life, Death and Other Troubles
Life, the struggle for existence
Life: New Game +
Life::Uploaded
LifeCraft
Lifeline
Lifestones of Lebreima
Lifeward
Light and Darkness of the Dragon Blades
Light Cleric
Light is suppose to be weak
Light of Gemini
Light of Shadows (Dropped...)
Light of the Heavens
Light of the Moon
Light Of The Nine
Light Rays
Lightning Does Strike Twice
Lightning Heroic
Lightning Soul Emperor
Lightning Watt
Lightning's Apprentice
Like Staring at the Sun
Lil ko's heart
Lil'dude and the Goth girl Elf
Lilac Moon
Lilia's Shadow (The Wastelands Book 1)
Lilies Over Roses, Spring Over Autumn
Lilith
Lilith's Evergarden
LIlith's Firstborn
Lilith, the Demon
Lily Bouquet - A Girls Love Anthology
Lily Ex Machina [COMPLETED]
LimeLight: The Galaxy's Deadliest Gladiator Gameshow
LimeLight: The Galaxy's Deadliest VR Gameshow
Limerence Somnium
Liminal Radiance
Liminal Radiance: Path Of Old Dreams
Limit Break
Limited Fears
Limited to Pampering in Marriage: Report to Captain, I'm Pregnant.
Limiter Off
Limitless
Limitless Adaptation
Limitless Lands
Limitless Lands Book 2, Conquest
Limitless Paradox System
Limits
Lineage I
Lineage: Rise of an Empire
Lingering Elements
Lings
Link
Linked
Lion's Heart
LionHeart
Lionheart - Chronicles of Two Worlds
Lionheart: Chronicles of Two Worlds
Liquid Magics
Lirgaid's Adventure
Lissana
Listen Now: A Harry Potter & Remus Lupin Hurt/Comfort Mentor Fic
Listonia Online
Litmmorpg
LITRPG (Book II) - Mecc 12 : Cannon Fodder (Unedited)
LitRPG - The Bastard Prince (Path of the Dragon Mage)
LitRPG Apocalypse (Working Title)
Litrpg What A Fun Way For The World To End
LitRPG: Grand Age - Lord Of Bloodlines
Little Baron & Big General
Little Beirut
Little Devil
Little Fish Dreameths of the Sky
Little Fox
Little Fox Soaring to Heaven
Little Giant
Little karma game
Little Legs
Little master in a new world
Little Miss Savage
Little presence and almost no shadow
Little Red: A fairy tale RPG
Little Thief Not anymore ~
Live by the Sword
Live Life Homunclus
Live So That You May Live
Lives Of The Immortals - Rise Of The Strongest Magician
Liveship
Livestream Hero
Living a Long Life as a Legend
Living a Regular Life with a Game System
Living Armor
Living as I please, As a loli Demon King
Living Free
Living Happily in Another World
Living in a Fantasy Sucks
Living In A Fantasy World
Living in a Game-Like World, is a Skill (Random Schedule)
Living in an Urban Fantasy
Living in another world in peace and harmony i think!!!??
Living in His Dreams
Living in His Dreams (Ongoing)
Living in my Own World!
Living in Paradise
Living in the Bones
Living in This World
Living Legend
Living Life as a Demon
Living Life As A Game: Through And Through
Living Life as a Plant in a Magical World, Quite Strange Right?
Living My Second Life My Way
Living Selfishly While Working Towards A Peaceful Life
Living Steel
Living the Fantasy
Living the Great Sage Life with my Fairies and Lovers in a New World
Living Weapons
Living With Job System On Earth
Living With Loba: A Yandere Story
Living With Magic
Lizardventures
Lizzy Langdale and the Unassigneds
LMF = Legendary Midnight Farmer
Load State 01
Load Them Up!
Loaded Dice
Loading...
Lobotomy Corporation: Second Wave
Local Heroes
Locking Horns, Breaking Teeth.
Locking Horns, Breaking Teeth. [Minotaur Paladin Rewrite.]
Log of a Slime Evolutionist
Logi the Verglade
Logical Labyrinth
Lohikarmen: A tale of humans and dragons
Loiterous
Loki's Daughter, Tales of the Opal Dungeon
Loki: The Burden of the Throne
Loli Saga
Lolly
Lone Alpha.
Lone Survivor
Lone Wolf
Lone's Story Playground!
Lone: The Wanderer
Lone: The Wanderer [Rewrite]
Loneliness
Lonely Boy
Lonely Light (Complete)
Lonely Witch and Abandoned Princess
Loner Boy
Loners' Aimeless Journey
Long Days, Long Nights
Long Experience
Long Island
Long Lost Traveler
Long Lost Traveler (Dropped)
Long Shadow
Long War
Long War [Old]
Longing
Longshot
Longshots
Looking Down From Olympus
Looking for My Future
Looking For Something Appropriate
Looking for the Sun
Looking through the window
Looks like I am a Cat-kin now?
Looks like I transmigrated into the body of a 'Saint'. What? I can do more!?
Loop - A time story
Loop of the destiny
Loose cultivator in a magical world
Loose End
Loose Screws
Loot Mule
Lorctbvrorpgiraadhesgiaclswintrashwmdlsamygiadwimtdkagmactbapdsbihtaoatln?!
Lord Azul
Lord Dead
Lord Fear
Lord Grayson
Lord of all vamps
Lord of Dawn
Lord Of Dreams
Lord of Flukes
Lord of Glory
Lord Of Goblins
Lord Of Horrors
Lord Of Horrors [DISCONTINUED]
Lord of lust
Lord of Monster
Lord of Nightmares (dropped)
Lord of the Ancient (古代の主)
Lord of the Apocalypse
Lord of the Branchless Path
Lord Of The Flies
Lord Of The Flora
Lord of The Heavenly Villa
Lord Of The Magus World
Lord of the Night
Lord of the Night Realm
Lord of the Seas
Lord of the skies
Lord Of The Spells
Lord of the Supernatural
Lord of the Void
Lord of the White Flame
Lord of Undeath
Lord of War: Pandæmonium
Lord Protector
Lord Shadow
Lord Universe Creator
Lord Werdinger
Lordrian who was.
Lore - Gaming
Lore - Underworld
Lore and Legend - The Werewolf
Lore Unleashed
Lorian Ellins
Lorian Ellins [Dropped]
Los
Loser of Tarinath
Losian
Losing My Pride in that Vixen's World
Lost
Lost Archive
Lost Between the End and Now
Lost Blood
Lost Call
Lost Chapters of Eschatology: Vanguard
Lost Child
Lost Concord
Lost Crimson (book 1)
Lost Eden
Lost Emperor
Lost Genesis: Lied
Lost Girl
Lost Heroes: Atalanta
Lost Identity
Lost in a Dream
Lost in a Magical World
Lost In A Universal Sandbox.
Lost in Acleirea
Lost in an RPG World
Lost in Love
Lost in Morgent
Lost In Space
Lost in the Echo
Lost in the New World
Lost in the Past
Lost In The Unknown
Lost in the Wind
Lost in Time
Lost In Translation
Lost Leaves
Lost Lume: Project Rosaria
Lost Magic
Lost on the other Side
Lost One
Lost Origins: Ressurection
Lost Realm
Lost Realms
Lost Shield
Lost Soul
Lost Soul Found Soul
Lost souls
Lost souls ( rewrite in progress.)
Lost Star
Lost to the Memories
Lost to the Mist
Lost Tomb of the Necromancer
Lost Within Another World
Love & Witch Craft (A Web Light Novel )
Love Against the Karaoke Heavens
Love and Anti-Peace
Love and Robots
Love at First Theft
Love Crafted
Love Crunch
Love Gone Wrong
Love Of Baybur [Participant in the Royal Road Writathon challenge]
Love Out Loud
Love Paradox
Love Thy Vampiress
Love with Danger in the Purple: Being Beloved by the Hardhearted Avenger
Love you to the bone
Love's Vicissitudes: A Pursuit of Beloved Wife
Love,War and Astrovia
Love.exe
LoveGame
Lovelight
Lovely kNight: Our kiss will save the world?!
Lover's Life Line system
Loving Violet
Loving You
Low effort generic wish fulfillment story
Lucas Everton
Lucia the Bard
Lucian
Lucid
Lucid Dream
Lucid dreamer
Lucid World
Lucifer Dark the summoned fallen angel
Lucinda the Shifter
Lucine: Nightmares of The Blood Moon Heiress
Luck Based?
Luck is a Charm
Luck is only an option
Luck Lockyer
Luckiest person in the world!
Lucks Requiem
Lucky
Lucky Dragon
Lucky Me!
Lucky Number Seven
Lucky Riot and the Mystic Dragon
Lucy Wickshire
Lucy Wickshire (warning: sexual content)
Lucy: I Was Reincarnated As The Queen of Vampires?!
Lume
Lumiere: The Astral Wanderer
Luminate Online
Luminether Online (The Adventures of DrollTroll)
Lummox Flummox
Luna
Luna Daemonium
Luna: the Lunatic
Luna: What Happened Last Night?
Lunar Eclipse
Lunar One
Lunar's Dawn
Lune Levant
Lupa's Quest:
Lust uncontrolled!
Lust uncontrolled! (Complete)
Lust, like Vengeance, Demands Red
Luster
Lustfalter's Collection of Short Stories and Poetry
Lustrous Odyssey
Luxury Cafe Owner
Lv1 Creature
Lyaga
Lyca: Rise of Asura
Lyle
Lyra's Tale - a second chronicle of the Children of the Bear
Lyre: The Beginning
Lys
M O R T
M'Destiny
M-chan Wars: Rise and Fall of the Cat Tyrant
M-King
M.M.O (Massive Multiverse Online)
M.O.T.H.E.R. Reborn
Mabbo's Obscure Short Stories
Macabre Mim
Mace of Domination
Machina Core - Bastion Academy Book 1
Machinarium
Machine Supreme
Mackie Jade and the Dragon Duchess
Mad House
MAD MAGUS: A Tale of Almost Gods
Mad Moon
Mad Sci Soc
MAD Wendigo
Madi
Madly insane
Madly insane (dropped)
Madness
Madness with a touch of sanity
Madness, with a pinch of salt
Maelstrom - New Generation
Maelstrom book 1 - A new beginning
Maelstrom Interlude - Defiance
Maestro Therapy
Mafia God!
Mage
Mage Blessed
Mage Hunter
Mage of the Abyss
Mage Slayer
Mage vs. Modern Society
Mage without mana
Mage x Magician
Mage's Rebirth
Magefall
Magenta
Mages of Temberlon: Growing Shadows
MAGES: Ascension : Hiatuss Infinitetum
Magi
Magia: Et Mosa Vero de Mundo (Magic: The World of Mesa)
Magic & Love
Magic & The Mafia
Magic Academy ( hiatus)
Magic and Martial War God
Magic and Mayhem
Magic and Mayhem (old)
Magic and Mercenaries. What can go wrong?
Magic and time
Magic Barbarian
Magic Beast Eaters
Magic Conquest / A Way to Magical World? or Not
Magic Continent Zero
Magic Fighter
Magic Frenzy
Magic God of DxD
Magic Gunslinger
Magic is Magic
Magic is Overrated
Magic is Power
Magic is Unusable, but at Least We Have a TP-82 Cosmonaut Survival Pistol
Magic Knight Legends: The Phoenix Empire Pilgrimage
Magic Marble in Space
Magic Monsters Money
Magic Not included
Magic of love (a GB yuri yandere story)
Magic of the Extinct
Magic Online
Magic Squared
Magic Swordsman, King Slayer.
Magic System: Becoming a Deity
Magic With You (BL)
Magic Within: A Thiefs End
Magic Zero
Magic, Monsters and Medieval Mayhem.
Magic, Monsters, And Other Things
Magic-Farming
Magic-Smithing
Magic;World
Magica Storia
Magicae Machina
Magical Academy Life
Magical Adventure
Magical Beasts
Magical Cosmic
Magical Crossover
Magical Fantasy Land
Magical Fraulein and the World Euphonics
Magical Girl Gang Wars
Magical Girl Selector
Magical Paradise
Magical Popcorn
Magical Puzzle
Magical Science
Magical Taboo
Magical Tournament: Rise Of The Black Swan
Magical Ume Knight
Magical World Domination
Magicat
Magicbound to a Snake Girl
Magician Endeavour
Magician's Code
Magician's Stigmata
Magician's Touch (Deadly Touch Book 3)
Magick Alive
Magick Online
Magicka Crest
Magidrasa
Magik
Magik Obelisk Rewrite
Magik Online
Magikarp Used Splash
Magikind
Magikind [Original]
Magikind [Rewrite]
Magitech Awakenings
Magitist
Magium
Magma Core ( A Mage's Journey)
Magnum Opus
Magnus
Magnus of Theta
Magpie People
Magune: Let The Magnet Rise
Magus Gravity
Magus In Another World
Magus Of Darkness
Magus of Soul
Magus Sunt Inferus
Mahnu, An Immortal's Journey
Mahou Shoujo Hologram Universe - A Grand Eye Tale
Mahou Shoujo Reincarnation
Mahouka x RoyalRoad By lolandylol
Mai Girl
Maiden of Fire
Maiden's Moon
Mail Fox Tales
Mail Order Bride (Novel)
Main Character in Author's World
Mainstream Apocalypse
Majai
Majeera Chronicles
Major Naird's Fantasy
Majority Rule
Make God Bleed!
Make It Twenty Three
Make Me the Protagonist, Please!
Make Me Wanna Die by Rock
Make No Mistakes
Make Way for the Villainess
Make Your Mark and Other Stories
Maker
Maker Of A Universe
Making a difference
Making a Mark In The World
Making an Island
Making an Island (ReWrite)
Making magic, Forging fame.
Making my own Harem (dropped)
Making the best of a Betrayal
Making the best out of an Accident
Maksim's bluff
Mal
Malcolm and the Toe Goblins
Male Spy at an All-Girl's School
Maleficence
Malheur aux vaincus - Short stories
Malicious Arts
Malicious Arts: Astropolis Memorandum
Malicious, Magical, Malfoy
Malt the Manslayer
Malus Peior Pessimus
Mama Bear
Man From Earth
Man from the machine
Man from the Machine - The third Order
Man in Demon's Skin
Man In The Moon
Man of Earth
Man of the Hot Spring
Man Vs Edythe
Man With a Mace
Man With Many Faces
Mana
Mana : The Embodiment of Nature
Mana Anxiety
Mana apocalypse book one becoming mages
Mana king
Mana Reincarnation
Mana Rule
Mana System - Hello, World!
Mana System - Hello, World! [REVISED]
Mana Tank Magus
Mana Unleashed Evolved
Mana Wall
Mana Wall: Book One
Mana World - Convergence
Mana's Champion
Mana-Script
Mana-Sight: The Ken Barnes Story
Mana: The Bay Area
Manablood Mellie
Manablood Mellie Isekai
ManaBorn
Manapocalypse
Mancers Grimoire
Mand'alor The Undying
Mandala
Mandate of Heaven
Mandatory Isekai System
Manifest Fantasy
Manifest of Dao
Manifestations of Faith
Manifestations of faith: Return of the creators.
Manipulations
Mankind's Blessing
Mankind's Blessing: Time Traveling in Another World
Mankind's Judgement
Manor on Server Seven
Manticore
Manticore's Rise.
Mantid
Mantid - Fantasy Isekai LitRPG
Manufacturing Magic
Manufacturing Magic (LitRPG)
MANUS DEI (On hiatus. Pending rewrite)
Many many disoster
Maou : Summoning
Maou : Summoning [Hiatus]
Maou Decides to Write a Shoujo
Maou Shoujo Magical Chaos
Maou the Yuusha
Map of Mercury: The Buried City
Map to Hope
Maple Creek
Marae
Marakar
March City (Project Lunation Book 1)
Marcus Dungeon
Mare Nostrum
Margrave's Divinity
Margrave's Divinity (Rewrite)
Maria's Adventure
Mariah's Missing Sisters
Marionette of Chaos Magic: Evandaria
Marissa
Mark of a dragon
Mark of a Witch (Black Butler/Kuroshitsuji Fanfic)
Mark of the Fool: A Progression Fantasy
Mark of the Triad
Marked (The Crystal Saga series book 2)
Marked Soul
Maroon Odyssey
Maroon Odyssey: Story of the survivors of a plane crash in a magical world
Marred Worlds [Discontinued]
Marriage And Monsters - An Eschatological Romance
Marrok's Loyalty
Marrow
Marrow Marionette
MarSide (Oneshot/Teaser)
Martial Academy (武灵学院)
Martial and Soul Cultivation: Yun Xe
Martial artist on a Mage World
Martial Crafter (Stopped)
Martial Family
Martial Flame
Martial God has Some Magic Troubles
Martial God with Naruto System in Another World
Martial King's Lewd Dreams
Martial Legend
Martial Legend [DROPPED]
Martial Life Online
Martial Magus
Martial Morpher
Martial necro
Martial path!
Martial Rebirth
Martial Resolve
Martial Road
Martial Spirit
Martial Spirit Ascendance!
Martial Striking Technique
Martial Void King
Martial World
Martial World & Summoned Hero
Martial World (Assasisin)
Martin's Life
Marvel elixir: Rise of mutant empire
Marvel Fanfic: Umbra
Marvel Gets Bizzare
Marvel Wild Fiction
Marvel's Cloak: Shroud of Darkness
Marvel's Phantom
Marvel+DC
Marvel: We Are Venom
MARY: The Dreadful
Mask
Masked Magicians: Savior
Masking Tape
Masks: Greed
Masochism and psychopathy is my way of living
Masochist Berserker
Masquerade of Life
Masquerade of Souls
Master Alchemist
Master Bard
Master Dungeon Network
Master Exorcist
Master Healer, At Your Service!
Master Magician's Summoned Problems
Master Necromancer
Master Of All
Master of All trades
Master Of All Trades, Jack Of None
Master of All, Jack of None
Master of Ceremonies
Master of combat in a Different World
Master of divine blood
Master Of Dungeon
Master of Dungeons
Master Of Everything
Master Of Everything (Completed?)
Master of Experimental Magic
Master of Heaven
Master of Jade Cauldron
Master of Learning (Book 2)
Master of Learning (Color coded)
Master Of Music (may change)
Master of None
Master Of The Dark Arts
Master of the Monster System
Master of the Multiverse
Master of the System
Master of the Void
Master of Weapons
Master Thief
Master Trainer Rei
Master's Doll
Masternever And The Flow Of Death
Masters
Masters of Shadow and Light
Mastery
Masthead
Mated To You
Materialize
Math God Plane - On Hiatus
Mathew The Mortal
Matt's Unfortunate New Life as a Woman
Matters of the Heart
Matty's Misadventure
Maverick Engineer Saga
Max and Myx in Estrella
Maximus
Maxing Out From the Start!
May Aien Have Mercy
Mayaken
Maybe A Savior
Maybe it would have been a good idea not to wish for a harem?
Maybe it would have been a good idea not to wish for a harem? Completed
Mayfear
Mayhap Jak saga
Mayhem of Magic
Maze
MAZE- The Endless Quest
Mc's not part of the story
McShot's Crazy House: Many Stories in One Setting, It's an Anthology!
MCU inhumain Izel l'eternel
MCU Oneshots and Novellas
MCU'S Ghost
MDW's WebNovel Incubator
Me and My Army of Magical Beasts
Me and Myself (In Our Twin World Conquest Reverie)
Me Dragon
Me, My Car, and My Dreams Girl
Me, Myself, And I.
Me, Myself, And I. A journey with my Inner Dialogue
Me, The World and Everything About it
Me? Dragon
Me? Dragon?
Meakashi Collection
Meaning
Meant To Be Rivals
Meanwhile
Meanwhile at the Withershins Inn...
Meat
Meat Eaters
Mecchen House
Mech Domination
Mecha In Cultivation World
Mecha Stalin Massacre (An alternate-universe steampunk LitRPG)
Mechanica Fantasy Offline
Mechanical Heart
Mechanical Sect
Mechanization against magic
Mechanoid Gear : Survivor of Trezallion
Mechs? Mex? Mex's mechs!
Mechshift
Mecromancer Chronicles
Mecromancer Chronicles (Rough Draft)
Medic!~
Medical Wolf
Medieval Centuries Online
Medieval Terror
Mediocre in Another World
Meditation
Medium Meld (Naruto/Gamer, OC)
Medley of Fates Worse than Death
Medley of Fates Worst than Death
Medusa and the blind woman
Meet The Freak
Meeting myself
Mega Cringe: Dab
Mega fantasy
Megane Saga
Mekaboru
melancholy Fox
Melancholy of the 31st Demon King
Melas
Melas [Original]
Melas [Original] [Discontinued]
Melas [Rewrite]
Melee Warrior of Combat
Meliar
Mellie Mellie isekai
Mellinnium Myths
Melodious Requiem
Melvin The Necromancer
Memento Mori
Memento Mori: Death Incarnate
Memoires of a Necromancer
Memoirs of a Monster Hunter
Memoirs Of A Withered Flower
Memoirs of an old traveler:First Rebirth
Memoirs of Karas Pesuto
Memoirs of the Broken
Memoriam Mine
Memories in Purgatory
Memories Like A Dagger
Memories of a Trained Killer
Memories Of Alice
Memories of the Fall
Memory Seal
Memorybound
Mending Chaos
Menoitami
Menschenjaeger
Menstex
Mental Note
Mental World Online
Mercenary King
Merchanicide
Merchant
Merchant Contract
Merchant of the End
Merchant Queen
Merchanting Around The World
Mercury Rising
Mercury's Daughter
Meritocracy
Merlin: The man who forged his own destiny
Merticore
Messenger
Messiah: Soldier of the Orient
Meta-human: Brainstorm vs Omni
Metagame
Metahuman
Metahuman Maiden
Metal and Magic
Metal Elemental
Metal Lich
Metal Lich isekai to another world
Metal Samaritan (short story)
Metalbound
Metallic Blood [A Cyberpunk LitRPG]
Metallic Mind (working title)
Metamorph
Metamorphosis
METAMORPHOSIS - devouring Its way to immortality
Metaworld Chronicles
Metempsychosis
Method Of Loci
Methodical Mind
Metropolis
MHA: Villainous Conquest
Mhaieiyu - Arc 1: The Syndicate
Mhaieiyu - Arco 1: El Sindicato
Micah Ever After
Micchi Versus the New World
Michael Ammers: My OP leisure life
Michael Sawyer: Paranormal Investigator
Micro Evolution
Micro-Management: Survival Base
Midara: Paradox
Midara: Requiem
Midas Touch
Middle Management In Another World
Middle School Nostalgia
Midgard
Midnight Drive
Midnight Frost. A Winterwatcher Wings of Fire Fanfiction
Midnight in St. Petersburg
Midnight Moonlight
Midnight Moratorium
Midnight Raven (formerly known as: LazyTrash's Book-a-ma-bob)
Midnight Sun
Midnight Torches
Midnight: Dark Horizon
Mifeln's Story Collection
Might of Alchemy
Mighty Malice
Mighty Sword King
Mikan Love
Mikayla the Dungeon?
Mike's Resting Place: Multiverse Pit Stop
Military Girl in the Zombie Apocalypse (Under Revision)
Milky Way (Wuxia/Si-Fi/Space)
Millennia
Millennium Dungeon: War
Million Choices
Millstones of Destiny
Milo
Milton
Milton Merryweather and the Terrible, Horrible, No Good, Very Bad Adventure
Milton Merryweather and the Terrible, Horrible, No Good, Very Bad Day
Mimi O Saku
Mimicked
Mimicking The Gods [Hiatus]
Mimicking The Gods [Rewrite]
Mimicry New Life
Mind
Mind Ambition
Mind Linker
Mind Net
Mind of a Healer
Mind of the Minotaur: Tower Seed
Mind over Matter
Mind Reading Isn't Cheating
Mind Riot
Mind Stealer
Mind your Manors, please.
Mindcrawlers
Mindflaying Rebirth
Minding Others' Business
Mindshifter: The Mind War
Mindslaver
Mine
Mine from the Abyss
Minecraft Chronicles: Last Human
Minecraft power in a strange world
Minecraft: A New Beginning
Minecraft: Last Human
Minecraft: The Story Begins!
Minecrafts Reality
Miner's Luck
Miner, miner?
Minglings
Minigun & Magic
Minor Mage
Minute Cultivator: Greatest Anomaly Teleported Ever (A.K.A: THE ULTIMATE GENIUS!!!!) o^T-T^o do you even lift bruh?
Miracle [Book 1]
Miracle Child: Slash The Gods [Dxd Universe] . (Mature Content)
Miracle Match Making App (MMMA)
Miraculous Spider Man
Mironov
Mirror Mirror
Mirror World: The Citadel by Alexey Osadchuk
Mirrored Cuts
miRrOred diMenSioNs
Misadventure of the Goddess of Death
Misadventures in a Cultivation World!!
Misadventures Of a Broken Dungeon Core
Misadventures of a Rampaging Demon
Mischief of Pantheons
Mischievous Dungeon
Misery and Hope
Misfits [Naruto/Gamer]
Misfits Of Fantasy
Misfits' Romance Society
Misfortune Night House
Mispaced Core
Miss Ophelia (A Draco Malfoy Love Story)
Missing Hattie
Mission Hearthwave
Missteps: A D&D Adventure
Mist
Mistaken Land: A Gamer's life in an another world
Mistakes Lead To Success
Mistakes Were Made: Short Stories That Shouldn't Be
Mistball Academy
Mistbound: Eternity
Mister Tadeus
Mists of Ansehelm
Mists of Creation
Mists of Kel Doran: Season One - Dragon-Touched
Mists of Redemption
Mistwalker Xyn and the Cult of Eldritch Evil
Mistworld - Book 1 - Couch Potato Chaos
Mite
Mithra
Mixed Martial Cultivator
Mixing Blood
MLG Gaming
MLM Saga
MLP Equestria Girls - Lucky Chances
MMO Earth - The Culling